BLASTX nr result
ID: Mentha22_contig00014901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00014901 (425 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002447732.1| hypothetical protein SORBIDRAFT_06g014760 [S... 55 8e-06 >ref|XP_002447732.1| hypothetical protein SORBIDRAFT_06g014760 [Sorghum bicolor] gi|241938915|gb|EES12060.1| hypothetical protein SORBIDRAFT_06g014760 [Sorghum bicolor] Length = 478 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 2/37 (5%) Frame = +3 Query: 30 ENSWG--KQSTGSKSWSYRALRGSALGPTMAMLRSKN 134 EN WG KQ+ + +WSYRALR SALGPTMAMLR KN Sbjct: 429 ENGWGTWKQNASTSAWSYRALRSSALGPTMAMLRGKN 465