BLASTX nr result
ID: Mentha22_contig00014296
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00014296 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU46635.1| hypothetical protein MIMGU_mgv1a001030mg [Mimulus... 92 1e-16 >gb|EYU46635.1| hypothetical protein MIMGU_mgv1a001030mg [Mimulus guttatus] Length = 908 Score = 91.7 bits (226), Expect = 1e-16 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 1/118 (0%) Frame = +3 Query: 3 ESSEGGSSRRMDNLLDLDHMSIDRSPMLVIHAARDLSKPIISCTLQNTCNGNHVNNATIS 182 ESSEGG SRRM+NLL+LD+MS DRSP+LV HAA DL N +A + Sbjct: 786 ESSEGGLSRRMENLLNLDYMSPDRSPILVRHAASDL-------------NTEKEESANLK 832 Query: 183 RSSSLGNEMQSLKVDDTNPDAEILLPSRI-DADADFSPLFKEGYYNKLEFLDRHNSTD 353 S + GNE+ S VD+ + +E L+ S+ + DF+ LFKE YYNK EF DR ST+ Sbjct: 833 ASLTEGNEIPSSNVDNADSASENLMHSKSEEKTVDFAQLFKEEYYNKPEFHDRDRSTE 890