BLASTX nr result
ID: Mentha22_contig00013965
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013965 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004960246.1| PREDICTED: NADPH--cytochrome P450 reductase-... 58 2e-06 gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapody... 57 3e-06 ref|XP_002534464.1| cytochrome P450, putative [Ricinus communis]... 56 6e-06 ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-... 55 8e-06 >ref|XP_004960246.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Setaria italica] Length = 707 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 1 YVCGDAKGMARDVHRTLHTIVQEQVCHCPSINER 102 YVCGDAKGMARDVHR LHTIVQEQV +C S +R Sbjct: 645 YVCGDAKGMARDVHRVLHTIVQEQVGNCVSSLKR 678 >gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana] Length = 709 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = +1 Query: 1 YVCGDAKGMARDVHRTLHTIVQEQVC 78 YVCGDAKGMARDVHRTLHTIVQEQ C Sbjct: 660 YVCGDAKGMARDVHRTLHTIVQEQGC 685 >ref|XP_002534464.1| cytochrome P450, putative [Ricinus communis] gi|223525245|gb|EEF27920.1| cytochrome P450, putative [Ricinus communis] Length = 694 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/25 (100%), Positives = 25/25 (100%) Frame = +1 Query: 1 YVCGDAKGMARDVHRTLHTIVQEQV 75 YVCGDAKGMARDVHRTLHTIVQEQV Sbjct: 666 YVCGDAKGMARDVHRTLHTIVQEQV 690 >ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer arietinum] Length = 700 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 3/34 (8%) Frame = +1 Query: 1 YVCGDAKGMARDVHRTLHTIVQEQ---VCHCPSI 93 YVCGDAKGMARDVHRTLHTIVQ+Q V H PS+ Sbjct: 643 YVCGDAKGMARDVHRTLHTIVQQQVRIVFHHPSL 676