BLASTX nr result
ID: Mentha22_contig00013943
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013943 (354 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 68 2e-09 tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 68 2e-09 tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-tran... 68 2e-09 ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea ma... 68 2e-09 gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK... 68 2e-09 ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797... 67 2e-09 ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 67 2e-09 ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citr... 67 2e-09 ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citr... 67 2e-09 gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlise... 67 2e-09 ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 67 2e-09 ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomeras... 67 2e-09 ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycin... 67 2e-09 ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [S... 67 2e-09 ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-proly... 67 2e-09 ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phas... 67 3e-09 ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomera... 67 3e-09 ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prun... 67 3e-09 dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] 67 3e-09 ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyra... 67 3e-09 >ref|XP_004975178.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Setaria italica] Length = 214 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 253 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 181 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >tpg|DAA48874.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 198 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 253 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 165 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 198 >tpg|DAA48872.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Zea mays] gi|414870316|tpg|DAA48873.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Zea mays] Length = 214 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 253 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 181 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 214 >ref|NP_001140628.1| uncharacterized protein LOC100272703 [Zea mays] gi|194700240|gb|ACF84204.1| unknown [Zea mays] gi|414870311|tpg|DAA48868.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870312|tpg|DAA48869.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 240 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 253 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 207 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 240 >gb|ACF82466.1| unknown [Zea mays] gi|195641426|gb|ACG40181.1| FK506 binding protein [Zea mays] gi|414870313|tpg|DAA48870.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] gi|414870314|tpg|DAA48871.1| TPA: putative FKBP-like peptidyl-prolyl cis-trans isomerase family protein [Zea mays] Length = 232 Score = 67.8 bits (164), Expect = 2e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNR 253 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN+ Sbjct: 199 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNQ 232 >ref|XP_006601815.1| PREDICTED: uncharacterized protein LOC100797411 isoform X1 [Glycine max] Length = 242 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 210 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 242 >ref|XP_006487561.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like isoform X1 [Citrus sinensis] Length = 267 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 235 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >ref|XP_006420812.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522685|gb|ESR34052.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 250 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 218 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 250 >ref|XP_006420808.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|567855379|ref|XP_006420809.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522681|gb|ESR34048.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] gi|557522682|gb|ESR34049.1| hypothetical protein CICLE_v10005642mg [Citrus clementina] Length = 267 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 235 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 267 >gb|EPS63301.1| hypothetical protein M569_11486, partial [Genlisea aurea] Length = 196 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPNRS 250 FSGQRALDFVLRNQGLIDKTLLFDIELLKI+PN S Sbjct: 161 FSGQRALDFVLRNQGLIDKTLLFDIELLKILPNGS 195 >ref|XP_007043768.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] gi|508707703|gb|EOX99599.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 2 [Theobroma cacao] Length = 255 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 223 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 255 >ref|XP_007043767.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] gi|508707702|gb|EOX99598.1| FKBP-like peptidyl-prolyl cis-trans isomerase family protein isoform 1 [Theobroma cacao] Length = 249 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 217 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 249 >ref|NP_001241480.1| uncharacterized protein LOC100797411 [Glycine max] gi|255646496|gb|ACU23726.1| unknown [Glycine max] Length = 241 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 209 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 241 >ref|XP_002445577.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] gi|241941927|gb|EES15072.1| hypothetical protein SORBIDRAFT_07g021890 [Sorghum bicolor] Length = 207 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 175 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 207 >ref|XP_002267989.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 7, chloroplastic isoform 1 [Vitis vinifera] gi|296085536|emb|CBI29268.3| unnamed protein product [Vitis vinifera] Length = 257 Score = 67.4 bits (163), Expect = 2e-09 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN Sbjct: 225 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 257 >ref|XP_007139197.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] gi|561012330|gb|ESW11191.1| hypothetical protein PHAVU_008G009400g [Phaseolus vulgaris] Length = 274 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIELLKI+PN Sbjct: 242 FSGQRALDFVLRNQGLIDKTLLFDIELLKIVPN 274 >ref|XP_004491988.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP19, chloroplastic-like [Cicer arietinum] Length = 240 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 208 FSGQRALDFVLRNQGLIDKTLLFDIELMKIIPN 240 >ref|XP_007226020.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] gi|462422956|gb|EMJ27219.1| hypothetical protein PRUPE_ppa010126mg [Prunus persica] Length = 262 Score = 66.6 bits (161), Expect = 3e-09 Identities = 32/33 (96%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFDIEL+KIIPN Sbjct: 230 FSGQRALDFVLRNQGLIDKTLLFDIELIKIIPN 262 >dbj|BAD42981.1| unknown protein [Arabidopsis thaliana] Length = 255 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFD+ELLKI+PN Sbjct: 223 FSGQRALDFVLRNQGLIDKTLLFDVELLKIVPN 255 >ref|XP_002873610.1| immunophilin [Arabidopsis lyrata subsp. lyrata] gi|297319447|gb|EFH49869.1| immunophilin [Arabidopsis lyrata subsp. lyrata] Length = 256 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 354 FSGQRALDFVLRNQGLIDKTLLFDIELLKIIPN 256 FSGQRALDFVLRNQGLIDKTLLFD+ELLKI+PN Sbjct: 224 FSGQRALDFVLRNQGLIDKTLLFDVELLKIVPN 256