BLASTX nr result
ID: Mentha22_contig00013671
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013671 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus... 78 1e-12 >gb|EYU23400.1| hypothetical protein MIMGU_mgv1a004206mg [Mimulus guttatus] Length = 539 Score = 78.2 bits (191), Expect = 1e-12 Identities = 42/69 (60%), Positives = 49/69 (71%), Gaps = 1/69 (1%) Frame = -1 Query: 377 CHHAVNQQP-HQNVGSNPPSSGKVPEGRVHGGNLMAMLAGAPSFDFPRGKPAVDTLDTEK 201 C + QP H GSN SSGKVPEGRVHGGNLMA+LAG P F+FP G A + + EK Sbjct: 473 CSNYFGYQPTHMPSGSNR-SSGKVPEGRVHGGNLMALLAGGPGFNFPSGDMAGPS-EPEK 530 Query: 200 SFMTHQSWM 174 SF+THQ+WM Sbjct: 531 SFVTHQTWM 539