BLASTX nr result
ID: Mentha22_contig00013263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013263 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446505.1| hypothetical protein CICLE_v10015874mg [Citr... 89 6e-16 ref|XP_006446503.1| hypothetical protein CICLE_v10015874mg [Citr... 89 6e-16 ref|XP_006446502.1| hypothetical protein CICLE_v10015874mg [Citr... 89 6e-16 ref|XP_006446501.1| hypothetical protein CICLE_v10015874mg [Citr... 89 6e-16 ref|XP_006446499.1| hypothetical protein CICLE_v10015874mg [Citr... 89 6e-16 emb|CCW28006.1| carbonic anhydrase [Petroselinum crispum] 89 8e-16 ref|XP_006470328.1| PREDICTED: carbonic anhydrase, chloroplastic... 87 2e-15 ref|XP_006470327.1| PREDICTED: carbonic anhydrase, chloroplastic... 87 2e-15 ref|XP_006470326.1| PREDICTED: carbonic anhydrase, chloroplastic... 87 2e-15 gb|EYU44749.1| hypothetical protein MIMGU_mgv1a009344mg [Mimulus... 86 7e-15 gb|EYU44748.1| hypothetical protein MIMGU_mgv1a009344mg [Mimulus... 86 7e-15 ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic... 83 3e-14 ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic... 83 3e-14 ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum] gi... 83 3e-14 gb|ABC41658.1| carbonic anhydrase 3 [Flaveria pringlei] 83 4e-14 ref|XP_006408515.1| hypothetical protein EUTSA_v10020995mg [Eutr... 82 6e-14 gb|ADZ97028.1| carbonic anhydrase 3 [Flaveria cronquistii] 82 6e-14 ref|XP_006408513.1| hypothetical protein EUTSA_v10020995mg [Eutr... 82 8e-14 ref|XP_006408512.1| hypothetical protein EUTSA_v10020995mg [Eutr... 82 8e-14 ref|XP_006408514.1| hypothetical protein EUTSA_v10020995mg [Eutr... 82 8e-14 >ref|XP_006446505.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549116|gb|ESR59745.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] Length = 284 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 236 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV 284 >ref|XP_006446503.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549114|gb|ESR59743.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] Length = 334 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 274 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV 322 >ref|XP_006446502.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549113|gb|ESR59742.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] Length = 322 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 274 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV 322 >ref|XP_006446501.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549112|gb|ESR59741.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] Length = 243 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 195 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV 243 >ref|XP_006446499.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|567908381|ref|XP_006446504.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549110|gb|ESR59739.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] gi|557549115|gb|ESR59744.1| hypothetical protein CICLE_v10015874mg [Citrus clementina] Length = 257 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 209 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPLSV 257 >emb|CCW28006.1| carbonic anhydrase [Petroselinum crispum] Length = 328 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR GL+N TLALKGGYYDF+ GSFELWGLDFSLSPP S+ Sbjct: 280 SLSNLLTYPFVRDGLVNKTLALKGGYYDFVNGSFELWGLDFSLSPPTSV 328 >ref|XP_006470328.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X3 [Citrus sinensis] Length = 269 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDF LSPP S+ Sbjct: 209 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFGLSPPLSV 257 >ref|XP_006470327.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 [Citrus sinensis] Length = 322 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDF LSPP S+ Sbjct: 274 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFGLSPPLSV 322 >ref|XP_006470326.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 [Citrus sinensis] Length = 334 Score = 87.4 bits (215), Expect = 2e-15 Identities = 39/49 (79%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+N TLALKGGYYDF+ GSFELWGLDF LSPP S+ Sbjct: 274 SLSNLLTYPFVREGLVNKTLALKGGYYDFVNGSFELWGLDFGLSPPLSV 322 >gb|EYU44749.1| hypothetical protein MIMGU_mgv1a009344mg [Mimulus guttatus] Length = 333 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLLSYPFVR+GL+N TLALKGGYYDFIKGSFELWGL+F LSP S+ Sbjct: 285 SLGNLLSYPFVREGLVNKTLALKGGYYDFIKGSFELWGLEFGLSPSLSV 333 >gb|EYU44748.1| hypothetical protein MIMGU_mgv1a009344mg [Mimulus guttatus] Length = 345 Score = 85.5 bits (210), Expect = 7e-15 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLLSYPFVR+GL+N TLALKGGYYDFIKGSFELWGL+F LSP S+ Sbjct: 285 SLGNLLSYPFVREGLVNKTLALKGGYYDFIKGSFELWGLEFGLSPSLSV 333 >ref|XP_006338560.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 333 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ TLALKGGYYDF+KG FELWGL+F LSPP S+ Sbjct: 273 SLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >ref|XP_006338561.1| PREDICTED: carbonic anhydrase, chloroplastic-like isoform X2 [Solanum tuberosum] gi|387157286|dbj|BAM15483.1| carbonic anhydrase, partial [Solanum tuberosum] Length = 321 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ TLALKGGYYDF+KG FELWGL+F LSPP S+ Sbjct: 273 SLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >ref|NP_001234048.1| carbonic anhydrase [Solanum lycopersicum] gi|56562177|emb|CAH60891.1| carbonic anhydrase [Solanum lycopersicum] Length = 321 Score = 83.2 bits (204), Expect = 3e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ TLALKGGYYDF+KG FELWGL+F LSPP S+ Sbjct: 273 SLGNLLTYPFVREGLVKKTLALKGGYYDFVKGGFELWGLEFGLSPPLSV 321 >gb|ABC41658.1| carbonic anhydrase 3 [Flaveria pringlei] Length = 328 Score = 82.8 bits (203), Expect = 4e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQS 174 SL NLL+YPFVR GL+N TLALKG +YDF+ G+FELWGLDFSLSPP S Sbjct: 280 SLANLLTYPFVRNGLMNKTLALKGAHYDFVNGAFELWGLDFSLSPPTS 327 >ref|XP_006408515.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] gi|557109661|gb|ESQ49968.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] Length = 363 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ GTLALKGGYYDFIKG+FELWGL+F LS S+ Sbjct: 283 SLANLLTYPFVREGLVKGTLALKGGYYDFIKGAFELWGLEFGLSETSSM 331 >gb|ADZ97028.1| carbonic anhydrase 3 [Flaveria cronquistii] Length = 327 Score = 82.4 bits (202), Expect = 6e-14 Identities = 37/48 (77%), Positives = 42/48 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQS 174 SL NLL+YPFVR GL+N TLALKG +YDF+ G+FELWGLDFSLSPP S Sbjct: 279 SLANLLTYPFVRNGLVNKTLALKGAHYDFVNGTFELWGLDFSLSPPTS 326 >ref|XP_006408513.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] gi|557109659|gb|ESQ49966.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] Length = 331 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ GTLALKGGYYDFIKG+FELWGL+F LS S+ Sbjct: 283 SLANLLTYPFVREGLVKGTLALKGGYYDFIKGAFELWGLEFGLSETSSV 331 >ref|XP_006408512.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] gi|557109658|gb|ESQ49965.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] Length = 259 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ GTLALKGGYYDFIKG+FELWGL+F LS S+ Sbjct: 211 SLANLLTYPFVREGLVKGTLALKGGYYDFIKGAFELWGLEFGLSETSSV 259 >ref|XP_006408514.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] gi|312281625|dbj|BAJ33678.1| unnamed protein product [Thellungiella halophila] gi|557109660|gb|ESQ49967.1| hypothetical protein EUTSA_v10020995mg [Eutrema salsugineum] Length = 342 Score = 82.0 bits (201), Expect = 8e-14 Identities = 37/49 (75%), Positives = 43/49 (87%) Frame = -1 Query: 317 SLENLLSYPFVRQGLLNGTLALKGGYYDFIKGSFELWGLDFSLSPPQSL 171 SL NLL+YPFVR+GL+ GTLALKGGYYDFIKG+FELWGL+F LS S+ Sbjct: 283 SLANLLTYPFVREGLVKGTLALKGGYYDFIKGAFELWGLEFGLSETSSV 331