BLASTX nr result
ID: Mentha22_contig00013244
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00013244 (440 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34759.1| hypothetical protein MIMGU_mgv1a016066mg [Mimulus... 59 9e-07 >gb|EYU34759.1| hypothetical protein MIMGU_mgv1a016066mg [Mimulus guttatus] Length = 135 Score = 58.5 bits (140), Expect = 9e-07 Identities = 33/57 (57%), Positives = 39/57 (68%), Gaps = 6/57 (10%) Frame = +1 Query: 1 DHFNPN-HSFCGHV-YPSFSFEFLLNPAAPPPLIRPE----SDGEADEGSVIRADSV 153 D NP HSF GHV YP+FSFEF LNP +P L RPE + +AD+ +VIRADSV Sbjct: 55 DSPNPKIHSFSGHVFYPTFSFEFFLNPNSPSSLFRPEPEPDEETDADDSNVIRADSV 111