BLASTX nr result
ID: Mentha22_contig00012944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00012944 (492 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007032932.1| WPP domain-interacting protein 1, putative i... 64 3e-08 ref|XP_007032931.1| WPP domain-interacting protein 1, putative i... 64 3e-08 ref|XP_004304181.1| PREDICTED: WPP domain-interacting tail-ancho... 61 2e-07 >ref|XP_007032932.1| WPP domain-interacting protein 1, putative isoform 2 [Theobroma cacao] gi|508711961|gb|EOY03858.1| WPP domain-interacting protein 1, putative isoform 2 [Theobroma cacao] Length = 719 Score = 63.5 bits (153), Expect = 3e-08 Identities = 55/128 (42%), Positives = 66/128 (51%), Gaps = 3/128 (2%) Frame = -2 Query: 491 RERLHKQISSLTKEKK-LSVKFLQHVKGPSDSAIKSPEGKVEEVKVCNNDSKNKS-NEQK 318 RERLH+QIS+L E K L VK Q K PS G V+E DS S NE+ Sbjct: 590 RERLHQQISALALENKILVVKLKQTDKDPSIIGSHENRGNVKEFLFSKQDSSTASANEEI 649 Query: 317 TGSSATCFETGNRESDSSKTGTNTRQDAPVSEADNVRNIDARQLNFKHV-LAVLMLAIPP 141 T SA E ++ S + + SE +NVR DAR LNFKHV LA+L+L I Sbjct: 650 TKLSADGSELD--KTTESVGESEVKPTDATSEFENVRRTDARLLNFKHVSLALLILLIS- 706 Query: 140 LAAFIFSQ 117 AA FSQ Sbjct: 707 -AAVYFSQ 713 >ref|XP_007032931.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma cacao] gi|590651592|ref|XP_007032933.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma cacao] gi|508711960|gb|EOY03857.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma cacao] gi|508711962|gb|EOY03859.1| WPP domain-interacting protein 1, putative isoform 1 [Theobroma cacao] Length = 718 Score = 63.5 bits (153), Expect = 3e-08 Identities = 55/128 (42%), Positives = 66/128 (51%), Gaps = 3/128 (2%) Frame = -2 Query: 491 RERLHKQISSLTKEKK-LSVKFLQHVKGPSDSAIKSPEGKVEEVKVCNNDSKNKS-NEQK 318 RERLH+QIS+L E K L VK Q K PS G V+E DS S NE+ Sbjct: 589 RERLHQQISALALENKILVVKLKQTDKDPSIIGSHENRGNVKEFLFSKQDSSTASANEEI 648 Query: 317 TGSSATCFETGNRESDSSKTGTNTRQDAPVSEADNVRNIDARQLNFKHV-LAVLMLAIPP 141 T SA E ++ S + + SE +NVR DAR LNFKHV LA+L+L I Sbjct: 649 TKLSADGSELD--KTTESVGESEVKPTDATSEFENVRRTDARLLNFKHVSLALLILLIS- 705 Query: 140 LAAFIFSQ 117 AA FSQ Sbjct: 706 -AAVYFSQ 712 >ref|XP_004304181.1| PREDICTED: WPP domain-interacting tail-anchored protein 1-like [Fragaria vesca subsp. vesca] Length = 656 Score = 60.8 bits (146), Expect = 2e-07 Identities = 48/135 (35%), Positives = 66/135 (48%), Gaps = 11/135 (8%) Frame = -2 Query: 491 RERLHKQISSLTKEKKLSVKFLQHVKGPSDSAIKSPEGKVEEVKVCNNDSKN------KS 330 RERLHKQ+SSLT E K + LQ PS V +CN+D N Sbjct: 536 RERLHKQMSSLTMENKTLILKLQMNNSPS-------------VVMCNDDRGNDDDCMLSK 582 Query: 329 NEQKTGSSATCFETGNRESDSSKTGTNTRQDAPVSE-----ADNVRNIDARQLNFKHVLA 165 +E TG+ + E + S+K T +DA +SE AD VR +DA LNFKHVL Sbjct: 583 HELDTGTKESREEAHELSAVSAKF-DRTHKDAFMSETEAGPADFVRRVDAGVLNFKHVLM 641 Query: 164 VLMLAIPPLAAFIFS 120 +++ + A + F+ Sbjct: 642 AVLIVLISAALYFFT 656