BLASTX nr result
ID: Mentha22_contig00012481
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00012481 (448 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU44777.1| hypothetical protein MIMGU_mgv1a011175mg [Mimulus... 64 3e-08 >gb|EYU44777.1| hypothetical protein MIMGU_mgv1a011175mg [Mimulus guttatus] Length = 290 Score = 63.5 bits (153), Expect = 3e-08 Identities = 31/49 (63%), Positives = 38/49 (77%) Frame = -3 Query: 437 QEESQQRKGKSRAEEETPAQAEARENAYKELHMGSFARIWNWMKRSTSQ 291 ++E+Q+ KS AEEETPAQA+ARENAY+EL GSF IW+WMK T Q Sbjct: 243 KQENQRNYAKS-AEEETPAQAKARENAYRELKKGSFDSIWSWMKNVTGQ 290