BLASTX nr result
ID: Mentha22_contig00012409
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00012409 (401 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus... 88 1e-15 ref|XP_007222298.1| hypothetical protein PRUPE_ppa003357mg [Prun... 72 1e-10 ref|XP_002276157.2| PREDICTED: clathrin interactor EPSIN 1-like ... 68 1e-09 emb|CBI20607.3| unnamed protein product [Vitis vinifera] 68 1e-09 ref|XP_002276103.1| PREDICTED: clathrin interactor EPSIN 1-like ... 68 1e-09 ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like ... 67 3e-09 ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isofo... 67 3e-09 ref|XP_006450772.1| hypothetical protein CICLE_v10007888mg [Citr... 66 4e-09 ref|XP_006450769.1| hypothetical protein CICLE_v10007888mg [Citr... 66 4e-09 ref|XP_006475977.1| PREDICTED: clathrin interactor EPSIN 1-like ... 64 2e-08 ref|XP_004498931.1| PREDICTED: clathrin interactor EPSIN 1-like ... 64 2e-08 ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like ... 64 2e-08 ref|XP_007160972.1| hypothetical protein PHAVU_001G032700g [Phas... 63 4e-08 ref|XP_007012223.1| ENTH/VHS family protein [Theobroma cacao] gi... 63 4e-08 ref|XP_004142914.1| PREDICTED: clathrin interactor EPSIN 1-like ... 63 4e-08 ref|XP_004251416.1| PREDICTED: clathrin interactor EPSIN 1-like ... 63 5e-08 ref|XP_004291011.1| PREDICTED: clathrin interactor EPSIN 1-like ... 62 8e-08 gb|EYU29308.1| hypothetical protein MIMGU_mgv1a004074mg [Mimulus... 62 1e-07 gb|EXB66907.1| hypothetical protein L484_019545 [Morus notabilis] 62 1e-07 gb|AFK49429.1| unknown [Lotus japonicus] 62 1e-07 >gb|EYU20387.1| hypothetical protein MIMGU_mgv1a004114mg [Mimulus guttatus] Length = 543 Score = 88.2 bits (217), Expect = 1e-15 Identities = 42/55 (76%), Positives = 48/55 (87%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTPLNDD 236 PKKV+L+ VGIVGGLTD S+EKDKG LPSFYMG MG+G+ GKSGFTSTPL+DD Sbjct: 472 PKKVNLSNVGIVGGLTDGSEEKDKGHLPSFYMGKAMGAGTAGGKSGFTSTPLDDD 526 >ref|XP_007222298.1| hypothetical protein PRUPE_ppa003357mg [Prunus persica] gi|462419234|gb|EMJ23497.1| hypothetical protein PRUPE_ppa003357mg [Prunus persica] Length = 582 Score = 71.6 bits (174), Expect = 1e-10 Identities = 35/51 (68%), Positives = 41/51 (80%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTP 248 PKKV+LA VGIVGGLTD S E++KGP S+YMG MGSG+ GKSGF S+P Sbjct: 506 PKKVNLADVGIVGGLTDGSDEREKGPPTSYYMGRAMGSGTGLGKSGFPSSP 556 >ref|XP_002276157.2| PREDICTED: clathrin interactor EPSIN 1-like isoform 2 [Vitis vinifera] Length = 552 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTP 248 PKK++LA VGIVGGL+D S E++KGP SF MG MG GS GKSGFTS P Sbjct: 477 PKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKSGFTSPP 527 >emb|CBI20607.3| unnamed protein product [Vitis vinifera] Length = 608 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTP 248 PKK++LA VGIVGGL+D S E++KGP SF MG MG GS GKSGFTS P Sbjct: 533 PKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKSGFTSPP 583 >ref|XP_002276103.1| PREDICTED: clathrin interactor EPSIN 1-like isoform 1 [Vitis vinifera] Length = 565 Score = 68.2 bits (165), Expect = 1e-09 Identities = 34/51 (66%), Positives = 39/51 (76%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTP 248 PKK++LA VGIVGGL+D S E++KGP SF MG MG GS GKSGFTS P Sbjct: 490 PKKINLADVGIVGGLSDGSDEREKGPQTSFSMGQAMGIGSGLGKSGFTSPP 540 >ref|XP_003544513.1| PREDICTED: clathrin interactor EPSIN 1-like isoform 1 [Glycine max] Length = 564 Score = 67.0 bits (162), Expect = 3e-09 Identities = 35/50 (70%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGS--MHGKSGFT 257 PKKV LA VGIVGGL+D S E++KGP PSFYMG MGSGS G+SGFT Sbjct: 489 PKKVSLADVGIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLGMGRSGFT 538 >ref|XP_003550292.1| PREDICTED: clathrin interactor EPSIN 1 isoform 1 [Glycine max] Length = 564 Score = 66.6 bits (161), Expect = 3e-09 Identities = 37/58 (63%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGS--MHGKSGFT-STPLNDD 236 PKKV L VGIVGGL+D S E++KGP PSFYMG MGSGS G+SGFT S P+ D Sbjct: 489 PKKVSLVDVGIVGGLSDGSDEREKGPPPSFYMGRAMGSGSGLGMGRSGFTPSQPIAGD 546 >ref|XP_006450772.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553998|gb|ESR64012.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] Length = 507 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTS 254 PKKV LA VG+VGGL+D S E++KGP SFYMG MG+G+ KSGFTS Sbjct: 435 PKKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGLSKSGFTS 483 >ref|XP_006450769.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|567917528|ref|XP_006450770.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|567917530|ref|XP_006450771.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553995|gb|ESR64009.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553996|gb|ESR64010.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] gi|557553997|gb|ESR64011.1| hypothetical protein CICLE_v10007888mg [Citrus clementina] Length = 561 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTS 254 PKKV LA VG+VGGL+D S E++KGP SFYMG MG+G+ KSGFTS Sbjct: 489 PKKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGLSKSGFTS 537 >ref|XP_006475977.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X1 [Citrus sinensis] gi|568844191|ref|XP_006475978.1| PREDICTED: clathrin interactor EPSIN 1-like isoform X2 [Citrus sinensis] Length = 561 Score = 64.3 bits (155), Expect = 2e-08 Identities = 31/48 (64%), Positives = 37/48 (77%) Frame = -2 Query: 397 KKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTS 254 KKV LA VG+VGGL+D S E++KGP SFYMG MG+G+ KSGFTS Sbjct: 490 KKVSLADVGVVGGLSDGSDEREKGPPTSFYMGRAMGTGTGFSKSGFTS 537 >ref|XP_004498931.1| PREDICTED: clathrin interactor EPSIN 1-like [Cicer arietinum] Length = 559 Score = 63.9 bits (154), Expect = 2e-08 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 2/57 (3%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFT--STPLNDD 236 PKKV L VGIVGGL+D S EK+KGP +FYMG MGSGS G SG T T DD Sbjct: 486 PKKVSLVDVGIVGGLSDGSDEKEKGPPTTFYMGRAMGSGSGLGMSGVTPSQTTAGDD 542 >ref|XP_004245127.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum lycopersicum] Length = 553 Score = 63.9 bits (154), Expect = 2e-08 Identities = 33/55 (60%), Positives = 38/55 (69%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTPLNDD 236 PKKV+LA VG+VGGLTD S E++KGP SFY MG G +GKSGF S P D Sbjct: 482 PKKVNLADVGVVGGLTDGSDEREKGP-TSFYSSKAMGQGIGYGKSGFPSAPTAGD 535 >ref|XP_007160972.1| hypothetical protein PHAVU_001G032700g [Phaseolus vulgaris] gi|561034436|gb|ESW32966.1| hypothetical protein PHAVU_001G032700g [Phaseolus vulgaris] Length = 563 Score = 63.2 bits (152), Expect = 4e-08 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 2/50 (4%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGS--MHGKSGFT 257 PKKV+LA VGIVGGL+D S EK+KGP PSF+MG MGSGS G+ GF+ Sbjct: 488 PKKVNLADVGIVGGLSDGSDEKEKGPPPSFFMGRAMGSGSGLGLGRPGFS 537 >ref|XP_007012223.1| ENTH/VHS family protein [Theobroma cacao] gi|508782586|gb|EOY29842.1| ENTH/VHS family protein [Theobroma cacao] Length = 561 Score = 63.2 bits (152), Expect = 4e-08 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTST 251 PKKV LA VGIVGGLTD+ + + P SFYMG MG+GS GK+GF ST Sbjct: 488 PKKVSLADVGIVGGLTDVDEREKGPPTTSFYMGRAMGTGSGLGKTGFAST 537 >ref|XP_004142914.1| PREDICTED: clathrin interactor EPSIN 1-like [Cucumis sativus] Length = 621 Score = 63.2 bits (152), Expect = 4e-08 Identities = 30/55 (54%), Positives = 40/55 (72%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTPLNDD 236 PKKV L VG+VGGL+D S E++KGP P+++MG MG+GS G++G S L DD Sbjct: 552 PKKVSLVDVGVVGGLSDFSDEREKGPAPTYHMGQAMGAGSGLGRTG--SQALGDD 604 >ref|XP_004251416.1| PREDICTED: clathrin interactor EPSIN 1-like [Solanum lycopersicum] Length = 537 Score = 62.8 bits (151), Expect = 5e-08 Identities = 33/55 (60%), Positives = 39/55 (70%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTPLNDD 236 P KV+LA VGI+GGLTD S K+KGP +FYMG MG G+ G+SGFTST D Sbjct: 468 PTKVNLADVGIMGGLTDGSDGKEKGP-TTFYMGRAMGQGTKLGQSGFTSTATGAD 521 >ref|XP_004291011.1| PREDICTED: clathrin interactor EPSIN 1-like [Fragaria vesca subsp. vesca] Length = 577 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/47 (65%), Positives = 36/47 (76%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGF 260 PKKV+LA VGIVGGLTD + E++KGP SF MG MGSG GKSG+ Sbjct: 506 PKKVNLADVGIVGGLTDGADEREKGPPTSFNMGRAMGSGMGLGKSGY 552 >gb|EYU29308.1| hypothetical protein MIMGU_mgv1a004074mg [Mimulus guttatus] Length = 545 Score = 61.6 bits (148), Expect = 1e-07 Identities = 35/57 (61%), Positives = 40/57 (70%), Gaps = 2/57 (3%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTSTP--LNDD 236 PKKV+LA VGIVGGLTD S+EK+KGP P MG MG GKSG T TP ++DD Sbjct: 476 PKKVNLADVGIVGGLTDGSEEKEKGPPPPLQMGKAMGV----GKSGSTPTPPIIDDD 528 >gb|EXB66907.1| hypothetical protein L484_019545 [Morus notabilis] Length = 578 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKGPLPSFYMGAPMGSGSMHGKSGFTS 254 PKKV L VG+VGGL++ EK+KGP S+YMG MG+GS G+SGF S Sbjct: 506 PKKVSLVDVGVVGGLSEGLDEKEKGPATSYYMGRAMGAGSGLGRSGFPS 554 >gb|AFK49429.1| unknown [Lotus japonicus] Length = 113 Score = 61.6 bits (148), Expect = 1e-07 Identities = 34/51 (66%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -2 Query: 400 PKKVDLAGVGIVGGLTDLSQEKDKG-PLPSFYMGAPMGSGSMHGKSGFTST 251 PKKV LA VGIVGGL+D EK+KG P PSFYMG MGSGS G SG S+ Sbjct: 41 PKKVSLADVGIVGGLSDGFDEKEKGTPPPSFYMGRAMGSGSGLGMSGVPSS 91