BLASTX nr result
ID: Mentha22_contig00012390
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00012390 (325 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS58144.1| hypothetical protein M569_16672, partial [Genlise... 60 4e-07 gb|EYU32215.1| hypothetical protein MIMGU_mgv1a003602mg [Mimulus... 58 1e-06 ref|XP_006491237.1| PREDICTED: probable indole-3-acetic acid-ami... 57 4e-06 ref|XP_006444881.1| hypothetical protein CICLE_v10019459mg [Citr... 57 4e-06 ref|XP_007220631.1| hypothetical protein PRUPE_ppa003388mg [Prun... 57 4e-06 >gb|EPS58144.1| hypothetical protein M569_16672, partial [Genlisea aurea] Length = 573 Score = 59.7 bits (143), Expect = 4e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 325 VSQFKTPRCVGPTNDTVLQILAVNGVRSYFSTAY 224 VSQFKTPRCV P NDT+LQIL N VR+YFSTAY Sbjct: 540 VSQFKTPRCVSPANDTLLQILCSNSVRNYFSTAY 573 >gb|EYU32215.1| hypothetical protein MIMGU_mgv1a003602mg [Mimulus guttatus] Length = 575 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 325 VSQFKTPRCVGPTNDTVLQILAVNGVRSYFSTAY 224 VSQFKTPRCVGP N VLQIL+VN V+SYFS+AY Sbjct: 542 VSQFKTPRCVGPNNGDVLQILSVNVVKSYFSSAY 575 >ref|XP_006491237.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like isoform X1 [Citrus sinensis] Length = 588 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 325 VSQFKTPRCVGPTNDTVLQILAVNGVRSYFSTAY 224 +SQFKTPRCVGPTN TVLQIL N +SYFSTAY Sbjct: 554 LSQFKTPRCVGPTNKTVLQILCNNIGKSYFSTAY 587 >ref|XP_006444881.1| hypothetical protein CICLE_v10019459mg [Citrus clementina] gi|568876338|ref|XP_006491238.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like isoform X2 [Citrus sinensis] gi|568876340|ref|XP_006491239.1| PREDICTED: probable indole-3-acetic acid-amido synthetase GH3.5-like isoform X3 [Citrus sinensis] gi|557547143|gb|ESR58121.1| hypothetical protein CICLE_v10019459mg [Citrus clementina] Length = 579 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 325 VSQFKTPRCVGPTNDTVLQILAVNGVRSYFSTAY 224 +SQFKTPRCVGPTN TVLQIL N +SYFSTAY Sbjct: 545 LSQFKTPRCVGPTNKTVLQILCNNIGKSYFSTAY 578 >ref|XP_007220631.1| hypothetical protein PRUPE_ppa003388mg [Prunus persica] gi|462417093|gb|EMJ21830.1| hypothetical protein PRUPE_ppa003388mg [Prunus persica] Length = 579 Score = 56.6 bits (135), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = -1 Query: 325 VSQFKTPRCVGPTNDTVLQILAVNGVRSYFSTAY 224 VSQFK PRCVGP N+TVLQIL N VRS+FSTAY Sbjct: 544 VSQFKAPRCVGPHNNTVLQILCGNVVRSFFSTAY 577