BLASTX nr result
ID: Mentha22_contig00011875
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011875 (335 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFG17072.1| GID1A [Vitis vinifera] 77 2e-12 emb|CBI34320.3| unnamed protein product [Vitis vinifera] 77 2e-12 emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] 77 2e-12 emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] 77 2e-12 gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] 77 3e-12 gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus... 75 7e-12 ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Popu... 75 7e-12 ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [... 75 9e-12 gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] 75 9e-12 gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] 75 9e-12 ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like i... 75 9e-12 ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus... 74 2e-11 ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citr... 74 2e-11 gb|AGU38487.1| GID1b [Camellia sinensis] 74 2e-11 gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|5117... 74 3e-11 ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prun... 74 3e-11 gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] 73 4e-11 gb|ACN86356.1| GID1-1 [Gossypium hirsutum] 73 4e-11 ref|XP_002512310.1| Gibberellin receptor GID1, putative [Ricinus... 73 4e-11 ref|XP_002319576.1| hypothetical protein POPTR_0013s02980g [Popu... 73 4e-11 >gb|AFG17072.1| GID1A [Vitis vinifera] Length = 344 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRRPD 38 >emb|CBI34320.3| unnamed protein product [Vitis vinifera] Length = 388 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRRPD 38 >emb|CAN68335.1| hypothetical protein VITISV_040540 [Vitis vinifera] Length = 435 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRRPD Sbjct: 368 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRRPD 405 >emb|CAN65915.1| hypothetical protein VITISV_000065 [Vitis vinifera] Length = 344 Score = 77.0 bits (188), Expect = 2e-12 Identities = 36/38 (94%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN+SESKRVVPLNTWILISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLSESKRVVPLNTWILISNFKLAYNLLRRPD 38 >gb|ABB89021.1| CXE carboxylesterase [Actinidia deliciosa] Length = 346 Score = 76.6 bits (187), Expect = 3e-12 Identities = 35/38 (92%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+NV+ESK+VVPLNTWILISNFKLAYNMLRRPD Sbjct: 1 MAGSNEINVNESKKVVPLNTWILISNFKLAYNMLRRPD 38 >gb|EYU46638.1| hypothetical protein MIMGU_mgv1a009369mg [Mimulus guttatus] Length = 344 Score = 75.5 bits (184), Expect = 7e-12 Identities = 35/38 (92%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN +ESKRVVPLNTWILISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNANESKRVVPLNTWILISNFKLAYNLLRRPD 38 >ref|XP_002302813.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] gi|222844539|gb|EEE82086.1| hypothetical protein POPTR_0002s22840g [Populus trichocarpa] Length = 344 Score = 75.5 bits (184), Expect = 7e-12 Identities = 34/38 (89%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN++ESKRVVPLNTW+LISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLLRRPD 38 >ref|XP_006362976.1| PREDICTED: gibberellin receptor GID1B-like [Solanum tuberosum] Length = 345 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRRPD Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRRPD 38 >gb|AHB17753.1| GA signaling receptor [Actinidia deliciosa] Length = 346 Score = 75.1 bits (183), Expect = 9e-12 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAG+NE+N++ESK+VVPLNTWILISNFKLAYNMLRRPD Sbjct: 1 MAGNNEININESKKVVPLNTWILISNFKLAYNMLRRPD 38 >gb|AGN72649.1| gibberellin receptor GID1B [Petunia x hybrida] Length = 345 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRRPD Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRRPD 38 >ref|XP_004240525.1| PREDICTED: gibberellin receptor GID1B-like isoform 1 [Solanum lycopersicum] Length = 345 Score = 75.1 bits (183), Expect = 9e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+N +ESKRVVPLNTWILISNFKL+YNMLRRPD Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLSYNMLRRPD 38 >ref|XP_002524767.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223535951|gb|EEF37610.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 345 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/38 (86%), Positives = 38/38 (100%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAG+NEVN++ESKRVVPLNTW+LISNFKLAYN+LRRPD Sbjct: 1 MAGTNEVNLNESKRVVPLNTWVLISNFKLAYNLLRRPD 38 >ref|XP_006444187.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] gi|568852325|ref|XP_006479828.1| PREDICTED: gibberellin receptor GID1B-like [Citrus sinensis] gi|557546449|gb|ESR57427.1| hypothetical protein CICLE_v10020963mg [Citrus clementina] Length = 344 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAG NEVN++ESKRVVPLNTW+LISNFKLAYN+LRRPD Sbjct: 1 MAGGNEVNLNESKRVVPLNTWVLISNFKLAYNLLRRPD 38 >gb|AGU38487.1| GID1b [Camellia sinensis] Length = 345 Score = 73.9 bits (180), Expect = 2e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+N +ESKRVVPLNTWILISN KLAYNMLRRPD Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNLKLAYNMLRRPD 38 >gb|AGN95005.1| gibberellin receptor 1b [Prunus salicina] gi|511782930|gb|AGN95007.1| gibberellin receptor 1b [Prunus salicina] Length = 344 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVNV+ESKRVVPLNTW+LISNFKLAYN+LRR D Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRRAD 38 >ref|XP_007200346.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|595793197|ref|XP_007200347.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395746|gb|EMJ01545.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] gi|462395747|gb|EMJ01546.1| hypothetical protein PRUPE_ppa008128mg [Prunus persica] Length = 344 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVNV+ESKRVVPLNTW+LISNFKLAYN+LRR D Sbjct: 1 MAGSNEVNVNESKRVVPLNTWVLISNFKLAYNLLRRAD 38 >gb|AFA35961.1| gid1-like gibberellin receptor [Nicotiana attenuata] Length = 345 Score = 73.2 bits (178), Expect = 4e-11 Identities = 34/38 (89%), Positives = 36/38 (94%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNE+N +ESKRVVPLNTWILISNFKLAYNMLRR D Sbjct: 1 MAGSNEINANESKRVVPLNTWILISNFKLAYNMLRRSD 38 >gb|ACN86356.1| GID1-1 [Gossypium hirsutum] Length = 344 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN++ESKRVVPLNTW+LISNFKLAYN+ RRPD Sbjct: 1 MAGSNEVNLNESKRVVPLNTWVLISNFKLAYNLQRRPD 38 >ref|XP_002512310.1| Gibberellin receptor GID1, putative [Ricinus communis] gi|223548271|gb|EEF49762.1| Gibberellin receptor GID1, putative [Ricinus communis] Length = 344 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN++ESK VVPLNTW+LISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLNESKMVVPLNTWVLISNFKLAYNLLRRPD 38 >ref|XP_002319576.1| hypothetical protein POPTR_0013s02980g [Populus trichocarpa] gi|222857952|gb|EEE95499.1| hypothetical protein POPTR_0013s02980g [Populus trichocarpa] Length = 344 Score = 73.2 bits (178), Expect = 4e-11 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -1 Query: 116 MAGSNEVNVSESKRVVPLNTWILISNFKLAYNMLRRPD 3 MAGSNEVN++ESK VVPLNTW+LISNFKLAYN+LRRPD Sbjct: 1 MAGSNEVNLNESKMVVPLNTWVLISNFKLAYNLLRRPD 38