BLASTX nr result
ID: Mentha22_contig00011801
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011801 (410 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43163.1| hypothetical protein MIMGU_mgv1a003141mg [Mimulus... 57 4e-06 gb|EYU43162.1| hypothetical protein MIMGU_mgv1a003141mg [Mimulus... 57 4e-06 >gb|EYU43163.1| hypothetical protein MIMGU_mgv1a003141mg [Mimulus guttatus] Length = 569 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 410 ILIYSDHQYRDVKAIEREVGGQFVELPAIAVGDDAMSMFSVMD 282 ILIYS HQYR+VK+IEREVG +F ELP IAV M M+ MD Sbjct: 445 ILIYSTHQYREVKSIEREVGCRFTELPKIAVDAATMEMYGRMD 487 >gb|EYU43162.1| hypothetical protein MIMGU_mgv1a003141mg [Mimulus guttatus] Length = 605 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/43 (65%), Positives = 32/43 (74%) Frame = -1 Query: 410 ILIYSDHQYRDVKAIEREVGGQFVELPAIAVGDDAMSMFSVMD 282 ILIYS HQYR+VK+IEREVG +F ELP IAV M M+ MD Sbjct: 445 ILIYSTHQYREVKSIEREVGCRFTELPKIAVDAATMEMYGRMD 487