BLASTX nr result
ID: Mentha22_contig00011712
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011712 (351 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU27324.1| hypothetical protein MIMGU_mgv1a005696mg [Mimulus... 57 2e-06 ref|XP_006353542.1| PREDICTED: uncharacterized protein LOC102591... 57 4e-06 ref|XP_004251676.1| PREDICTED: uncharacterized protein LOC101245... 57 4e-06 ref|XP_002514129.1| calmodulin binding protein, putative [Ricinu... 57 4e-06 >gb|EYU27324.1| hypothetical protein MIMGU_mgv1a005696mg [Mimulus guttatus] Length = 474 Score = 57.4 bits (137), Expect = 2e-06 Identities = 30/52 (57%), Positives = 32/52 (61%) Frame = +1 Query: 1 QTRALEQVNLSPRLPNGGLSNYGXXXXXXXXXXXXXXXXVSYMGLPSPRTPI 156 Q RALEQVNLSPRL NG SNYG V+Y+GLPSPRTPI Sbjct: 419 QFRALEQVNLSPRLVNGPFSNYGPIPSPRPSPKIRLSPRVAYIGLPSPRTPI 470 >ref|XP_006353542.1| PREDICTED: uncharacterized protein LOC102591923 [Solanum tuberosum] Length = 496 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = +1 Query: 1 QTRALEQVNLSPRLPNGGLSNYGXXXXXXXXXXXXXXXXVSYMGLPSPRTPI 156 Q RALEQVNLSPR+ NGG + YG ++YMGLPSPRTPI Sbjct: 441 QFRALEQVNLSPRVANGGFNMYGPIPSPRPSPKIRLSPRIAYMGLPSPRTPI 492 >ref|XP_004251676.1| PREDICTED: uncharacterized protein LOC101245524 [Solanum lycopersicum] Length = 493 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/52 (53%), Positives = 32/52 (61%) Frame = +1 Query: 1 QTRALEQVNLSPRLPNGGLSNYGXXXXXXXXXXXXXXXXVSYMGLPSPRTPI 156 Q RALEQVNLSPR+ NGG + YG ++YMGLPSPRTPI Sbjct: 438 QFRALEQVNLSPRVANGGFNMYGPIPSPRPSPKIRLSPRIAYMGLPSPRTPI 489 >ref|XP_002514129.1| calmodulin binding protein, putative [Ricinus communis] gi|223546585|gb|EEF48083.1| calmodulin binding protein, putative [Ricinus communis] Length = 541 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = +1 Query: 1 QTRALEQVNLSPRLPNGGLSNYGXXXXXXXXXXXXXXXXVSYMGLPSPRTPI 156 Q+RALEQVNLSPR+P G LSNYG ++YMGLPSPRT + Sbjct: 487 QSRALEQVNLSPRVPPGSLSNYGPIPSPRPSPQVRVSPRLAYMGLPSPRTRV 538