BLASTX nr result
ID: Mentha22_contig00011707
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011707 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU17810.1| hypothetical protein MIMGU_mgv1a002730mg [Mimulus... 90 4e-16 gb|EYU17809.1| hypothetical protein MIMGU_mgv1a002730mg [Mimulus... 90 4e-16 ref|XP_002527965.1| Elongation factor 1-alpha, putative [Ricinus... 58 2e-06 >gb|EYU17810.1| hypothetical protein MIMGU_mgv1a002730mg [Mimulus guttatus] Length = 642 Score = 89.7 bits (221), Expect = 4e-16 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 3/104 (2%) Frame = +1 Query: 1 PFKFDVPSPDDLVSSGLQSLKMQSKG---SGRDINIPVKLEVAAEEQESTSTSVTRERNN 171 PFKFD PSPDDLVS+GL+S+K +SKG S ++ I V+ E+ A+ S+S VTRER N Sbjct: 91 PFKFDAPSPDDLVSNGLRSVKSKSKGNILSKKETKIQVESELVAKGPVSSSVPVTRERRN 150 Query: 172 GVHEKDYIPSSGNKPQISHGNVNTKAMSSKSGKTEMTSEIKTAS 303 GV E D SGNK ++ + + SSK+ K E+ E KT++ Sbjct: 151 GVSENDSASGSGNKSEVFDTRMKAETSSSKTRKEEIIDEGKTST 194 >gb|EYU17809.1| hypothetical protein MIMGU_mgv1a002730mg [Mimulus guttatus] Length = 643 Score = 89.7 bits (221), Expect = 4e-16 Identities = 49/104 (47%), Positives = 67/104 (64%), Gaps = 3/104 (2%) Frame = +1 Query: 1 PFKFDVPSPDDLVSSGLQSLKMQSKG---SGRDINIPVKLEVAAEEQESTSTSVTRERNN 171 PFKFD PSPDDLVS+GL+S+K +SKG S ++ I V+ E+ A+ S+S VTRER N Sbjct: 92 PFKFDAPSPDDLVSNGLRSVKSKSKGNILSKKETKIQVESELVAKGPVSSSVPVTRERRN 151 Query: 172 GVHEKDYIPSSGNKPQISHGNVNTKAMSSKSGKTEMTSEIKTAS 303 GV E D SGNK ++ + + SSK+ K E+ E KT++ Sbjct: 152 GVSENDSASGSGNKSEVFDTRMKAETSSSKTRKEEIIDEGKTST 195 >ref|XP_002527965.1| Elongation factor 1-alpha, putative [Ricinus communis] gi|223532591|gb|EEF34377.1| Elongation factor 1-alpha, putative [Ricinus communis] Length = 670 Score = 57.8 bits (138), Expect = 2e-06 Identities = 40/104 (38%), Positives = 52/104 (50%), Gaps = 15/104 (14%) Frame = +1 Query: 1 PFKFDVPSPDDLVSSGLQSLKMQSKGSGRDINIPVKLEVAAEEQESTSTS---------- 150 PFKFDVPSPD+LVSSGL S K S+ SG D N+ K E +A + S S S Sbjct: 86 PFKFDVPSPDNLVSSGLHSSKRDSRDSGND-NVRGKNEASAIQSSSGSNSSFSLKPKPGV 144 Query: 151 ---VTRERNNGVHEKDYIP--SSGNKPQISHGNVNTKAMSSKSG 267 + +H D +P SS P+ H N++ + SS G Sbjct: 145 ASNFLEDSALSIHSSDEMPENSSALMPKGKHRNMDNSSSSSMIG 188