BLASTX nr result
ID: Mentha22_contig00011653
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011653 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC33389.1| putative metal-nicotianamine transporter YSL6 [Mo... 91 2e-16 ref|XP_007161672.1| hypothetical protein PHAVU_001G088900g [Phas... 91 2e-16 gb|AHA84244.1| putative metal-nicotianamine transporter YSL6 [Ph... 91 2e-16 gb|AFU82910.1| yellow stripe-like transporter 6, partial [Arachi... 91 2e-16 ref|XP_007031922.1| YELLOW STRIPE like 6 [Theobroma cacao] gi|50... 91 2e-16 ref|XP_006604157.1| PREDICTED: probable metal-nicotianamine tran... 90 3e-16 ref|XP_003553947.1| PREDICTED: probable metal-nicotianamine tran... 90 3e-16 ref|XP_003549112.1| PREDICTED: probable metal-nicotianamine tran... 90 3e-16 gb|ACU22673.1| unknown [Glycine max] 90 3e-16 ref|XP_002512906.1| hypothetical protein RCOM_1447130 [Ricinus c... 89 5e-16 ref|XP_004514626.1| PREDICTED: probable metal-nicotianamine tran... 89 6e-16 ref|XP_007215002.1| hypothetical protein PRUPE_ppa002401mg [Prun... 89 8e-16 ref|XP_003622146.1| Yellow stripe-like protein 1.1 [Medicago tru... 89 8e-16 gb|AEQ28191.1| yellow stripe-like protein 6 [Malus baccata var. ... 88 1e-15 ref|XP_004231762.1| PREDICTED: probable metal-nicotianamine tran... 87 3e-15 gb|ACL83357.2| yellow stripe-like protein 6.4 [Brassica juncea] 87 3e-15 ref|XP_006447029.1| hypothetical protein CICLE_v10014497mg [Citr... 86 4e-15 ref|XP_006447028.1| hypothetical protein CICLE_v10014497mg [Citr... 86 4e-15 ref|XP_006405407.1| hypothetical protein EUTSA_v10027673mg [Eutr... 86 5e-15 ref|XP_004975420.1| PREDICTED: probable metal-nicotianamine tran... 86 5e-15 >gb|EXC33389.1| putative metal-nicotianamine transporter YSL6 [Morus notabilis] Length = 675 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWT+PSAILSIF+++PPICMYF PS SS Sbjct: 629 KDAEDYAGAVASGLICGDGIWTVPSAILSIFRINPPICMYFGPSSSS 675 >ref|XP_007161672.1| hypothetical protein PHAVU_001G088900g [Phaseolus vulgaris] gi|561035136|gb|ESW33666.1| hypothetical protein PHAVU_001G088900g [Phaseolus vulgaris] Length = 676 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 630 KDAEDYAGAVASGLICGDGIWTIPSAILSIMRIDPPICMYFGPSSSS 676 >gb|AHA84244.1| putative metal-nicotianamine transporter YSL6 [Phaseolus vulgaris] Length = 666 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 620 KDAEDYAGAVASGLICGDGIWTIPSAILSIMRIDPPICMYFGPSSSS 666 >gb|AFU82910.1| yellow stripe-like transporter 6, partial [Arachis hypogaea] Length = 214 Score = 90.9 bits (224), Expect = 2e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSA+LSI +VDPPICMYF PS SS Sbjct: 168 RDAEDYAGAVASGLICGDGIWTIPSAVLSIMRVDPPICMYFGPSASS 214 >ref|XP_007031922.1| YELLOW STRIPE like 6 [Theobroma cacao] gi|508710951|gb|EOY02848.1| YELLOW STRIPE like 6 [Theobroma cacao] Length = 670 Score = 90.5 bits (223), Expect = 2e-16 Identities = 41/47 (87%), Positives = 45/47 (95%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DA+DYAGAVASGLICGDGIWTIPSAILSIF++DPPICMYF PS SS Sbjct: 624 RDADDYAGAVASGLICGDGIWTIPSAILSIFRIDPPICMYFGPSLSS 670 >ref|XP_006604157.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like isoform X2 [Glycine max] Length = 677 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 631 KDAEDYAGAVASGLICGDGIWTIPSAILSILRIDPPICMYFGPSTSS 677 >ref|XP_003553947.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like isoformX1 [Glycine max] Length = 674 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 628 KDAEDYAGAVASGLICGDGIWTIPSAILSILRIDPPICMYFGPSTSS 674 >ref|XP_003549112.1| PREDICTED: probable metal-nicotianamine transporter YSL6 isoform 1 [Glycine max] Length = 674 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 628 KDAEDYAGAVASGLICGDGIWTIPSAILSIMRIDPPICMYFGPSTSS 674 >gb|ACU22673.1| unknown [Glycine max] Length = 327 Score = 90.1 bits (222), Expect = 3e-16 Identities = 41/47 (87%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI ++DPPICMYF PS SS Sbjct: 281 KDAEDYAGAVASGLICGDGIWTIPSAILSIMRIDPPICMYFGPSTSS 327 >ref|XP_002512906.1| hypothetical protein RCOM_1447130 [Ricinus communis] gi|223547917|gb|EEF49409.1| hypothetical protein RCOM_1447130 [Ricinus communis] Length = 152 Score = 89.4 bits (220), Expect = 5e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSA+LSIF+++PPICMYF PS SS Sbjct: 106 KDAEDYAGAVASGLICGDGIWTIPSAVLSIFRINPPICMYFGPSLSS 152 >ref|XP_004514626.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like [Cicer arietinum] Length = 676 Score = 89.0 bits (219), Expect = 6e-16 Identities = 40/47 (85%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSAILSI +++PPICMYF PS SS Sbjct: 630 KDAEDYAGAVASGLICGDGIWTIPSAILSILRINPPICMYFGPSASS 676 >ref|XP_007215002.1| hypothetical protein PRUPE_ppa002401mg [Prunus persica] gi|462411152|gb|EMJ16201.1| hypothetical protein PRUPE_ppa002401mg [Prunus persica] Length = 677 Score = 88.6 bits (218), Expect = 8e-16 Identities = 40/47 (85%), Positives = 45/47 (95%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDY+GAVASGLICGDGIWTIPSAIL+IFKV+PP+CMYF PS SS Sbjct: 631 KDAEDYSGAVASGLICGDGIWTIPSAILAIFKVNPPVCMYFGPSLSS 677 >ref|XP_003622146.1| Yellow stripe-like protein 1.1 [Medicago truncatula] gi|355497161|gb|AES78364.1| Yellow stripe-like protein 1.1 [Medicago truncatula] Length = 679 Score = 88.6 bits (218), Expect = 8e-16 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DAEDYAGAVASGLICGDGIWTIPSA+LSI +++PPICMYF PS SS Sbjct: 633 KDAEDYAGAVASGLICGDGIWTIPSAVLSILRINPPICMYFGPSASS 679 >gb|AEQ28191.1| yellow stripe-like protein 6 [Malus baccata var. xiaojinensis] Length = 679 Score = 88.2 bits (217), Expect = 1e-15 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPS 224 +DAEDYAGAVASGLICGDGIWTIPSA+LSIF+V+PPICMYF PS Sbjct: 633 KDAEDYAGAVASGLICGDGIWTIPSAVLSIFRVNPPICMYFGPS 676 >ref|XP_004231762.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like [Solanum lycopersicum] Length = 674 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPS 224 +DAED+AGAVASGLICGDGIWTIPSAILSIF+++PPICMYF PS Sbjct: 628 KDAEDFAGAVASGLICGDGIWTIPSAILSIFRINPPICMYFGPS 671 >gb|ACL83357.2| yellow stripe-like protein 6.4 [Brassica juncea] Length = 678 Score = 86.7 bits (213), Expect = 3e-15 Identities = 38/47 (80%), Positives = 45/47 (95%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +DA+DYAGAVASGLICGDGIWTIPSAILSI +++PPICMYFKP+ +S Sbjct: 632 KDADDYAGAVASGLICGDGIWTIPSAILSILRINPPICMYFKPALAS 678 >ref|XP_006447029.1| hypothetical protein CICLE_v10014497mg [Citrus clementina] gi|568831698|ref|XP_006470096.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like [Citrus sinensis] gi|557549640|gb|ESR60269.1| hypothetical protein CICLE_v10014497mg [Citrus clementina] Length = 673 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +D+EDYAGAVASGLICGDGIWTIPSAILSIF+V+PP+CMYF P+ S Sbjct: 627 KDSEDYAGAVASGLICGDGIWTIPSAILSIFRVNPPVCMYFGPAVGS 673 >ref|XP_006447028.1| hypothetical protein CICLE_v10014497mg [Citrus clementina] gi|557549639|gb|ESR60268.1| hypothetical protein CICLE_v10014497mg [Citrus clementina] Length = 585 Score = 86.3 bits (212), Expect = 4e-15 Identities = 38/47 (80%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 +D+EDYAGAVASGLICGDGIWTIPSAILSIF+V+PP+CMYF P+ S Sbjct: 539 KDSEDYAGAVASGLICGDGIWTIPSAILSIFRVNPPVCMYFGPAVGS 585 >ref|XP_006405407.1| hypothetical protein EUTSA_v10027673mg [Eutrema salsugineum] gi|557106545|gb|ESQ46860.1| hypothetical protein EUTSA_v10027673mg [Eutrema salsugineum] Length = 676 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPS 224 +DA+DY+GAVASGLICGDGIWTIPSAILSIF+++PPICMYF PS Sbjct: 633 KDADDYSGAVASGLICGDGIWTIPSAILSIFRINPPICMYFGPS 676 >ref|XP_004975420.1| PREDICTED: probable metal-nicotianamine transporter YSL6-like [Setaria italica] Length = 673 Score = 85.9 bits (211), Expect = 5e-15 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -3 Query: 355 QDAEDYAGAVASGLICGDGIWTIPSAILSIFKVDPPICMYFKPSGSS 215 ++ ED+AGAVASGLICGDGIWT+PSAILSI ++DPPICMYFKPS +S Sbjct: 627 KECEDFAGAVASGLICGDGIWTVPSAILSILRIDPPICMYFKPSLAS 673