BLASTX nr result
ID: Mentha22_contig00011515
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00011515 (694 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374083.1| hypothetical protein POPTR_0015s00650g [Popu... 50 2e-06 ref|XP_002317830.1| hypothetical protein POPTR_0012s00770g [Popu... 50 6e-06 ref|XP_004137201.1| PREDICTED: uncharacterized calcium-binding p... 50 8e-06 >ref|XP_006374083.1| hypothetical protein POPTR_0015s00650g [Populus trichocarpa] gi|550321682|gb|ERP51880.1| hypothetical protein POPTR_0015s00650g [Populus trichocarpa] Length = 473 Score = 50.1 bits (118), Expect(2) = 2e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 82 FTMEVEKGVWP*DYSNSDHARLTVLFSPVR 171 F EVEKG+WP +YS SDHARLTV+FSP+R Sbjct: 436 FPPEVEKGMWPENYSLSDHARLTVVFSPIR 465 Score = 28.1 bits (61), Expect(2) = 2e-06 Identities = 11/17 (64%), Positives = 14/17 (82%) Frame = +2 Query: 38 GMDQTIGFGIKNAVLLP 88 G +QTIGF ++NAVL P Sbjct: 421 GEEQTIGFSVENAVLFP 437 >ref|XP_002317830.1| hypothetical protein POPTR_0012s00770g [Populus trichocarpa] gi|222858503|gb|EEE96050.1| hypothetical protein POPTR_0012s00770g [Populus trichocarpa] Length = 451 Score = 50.1 bits (118), Expect(2) = 6e-06 Identities = 22/30 (73%), Positives = 26/30 (86%) Frame = +1 Query: 82 FTMEVEKGVWP*DYSNSDHARLTVLFSPVR 171 F EVEKG+WP +YS SDHARLTV+FSP+R Sbjct: 414 FPPEVEKGMWPENYSLSDHARLTVVFSPIR 443 Score = 26.6 bits (57), Expect(2) = 6e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 44 DQTIGFGIKNAVLLP 88 +QTIGF ++NAVL P Sbjct: 401 EQTIGFSVENAVLFP 415 >ref|XP_004137201.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Cucumis sativus] gi|449483236|ref|XP_004156530.1| PREDICTED: uncharacterized calcium-binding protein At1g02270-like [Cucumis sativus] Length = 447 Score = 49.7 bits (117), Expect(2) = 8e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +1 Query: 82 FTMEVEKGVWP*DYSNSDHARLTVLFSPVR 171 F EVEKG WP DYS SDHARLTV+F+P+R Sbjct: 410 FPAEVEKGRWPEDYSLSDHARLTVVFAPIR 439 Score = 26.6 bits (57), Expect(2) = 8e-06 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = +2 Query: 44 DQTIGFGIKNAVLLP 88 +QTIGF ++NAVL P Sbjct: 397 EQTIGFSVENAVLFP 411