BLASTX nr result
ID: Mentha22_contig00010776
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010776 (548 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007212354.1| hypothetical protein PRUPE_ppa014563mg [Prun... 60 5e-07 ref|XP_006370321.1| hypothetical protein POPTR_0001s41630g [Popu... 57 2e-06 >ref|XP_007212354.1| hypothetical protein PRUPE_ppa014563mg [Prunus persica] gi|462408219|gb|EMJ13553.1| hypothetical protein PRUPE_ppa014563mg [Prunus persica] Length = 154 Score = 59.7 bits (143), Expect = 5e-07 Identities = 33/69 (47%), Positives = 44/69 (63%) Frame = -1 Query: 548 EGGRLGLGFTYYKNTFQLTKIGDSETLVDSTVDYVIGSEETSVAPGELVKSAIAFTRDVE 369 EGG L GF+ YK TFQLT+I + ET+V V Y E++S+ P + KS +AF R +E Sbjct: 88 EGGHLNFGFSSYKTTFQLTRIQEEETMVSVEVTYESQVEDSSM-PSKTAKSVLAFIRSLE 146 Query: 368 AFLLKNGPI 342 +LL NG I Sbjct: 147 CYLL-NGAI 154 >ref|XP_006370321.1| hypothetical protein POPTR_0001s41630g [Populus trichocarpa] gi|550349500|gb|ERP66890.1| hypothetical protein POPTR_0001s41630g [Populus trichocarpa] Length = 154 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/64 (43%), Positives = 39/64 (60%) Frame = -1 Query: 548 EGGRLGLGFTYYKNTFQLTKIGDSETLVDSTVDYVIGSEETSVAPGELVKSAIAFTRDVE 369 EGG L GF++YK TFQLT G+ ETL+D T+ Y EE +V P S + F + +E Sbjct: 88 EGGHLNHGFSHYKTTFQLTSTGEQETLIDVTISYESQVEEDTV-PSNSASSTLVFIKHME 146 Query: 368 AFLL 357 +L+ Sbjct: 147 NYLM 150