BLASTX nr result
ID: Mentha22_contig00010437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010437 (319 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18358.1| hypothetical protein MIMGU_mgv1a004873mg [Mimulus... 58 2e-06 >gb|EYU18358.1| hypothetical protein MIMGU_mgv1a004873mg [Mimulus guttatus] Length = 506 Score = 57.8 bits (138), Expect = 2e-06 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 2/70 (2%) Frame = +3 Query: 114 AKMSAIHQNVXXXXXXXXXXFLA-HNNLKSI-RPSHVSVAGRMNAVVKCVASTSAEKTAY 287 +KMSAIHQ + F+ H NLKS + S+ +VAG+++ VVKCVAS +AEKTAY Sbjct: 42 SKMSAIHQILSTSISSSASAFIGGHTNLKSATKSSNFAVAGKISGVVKCVAS-AAEKTAY 100 Query: 288 NTNVARNGNL 317 T V+RN N+ Sbjct: 101 TTKVSRNENM 110