BLASTX nr result
ID: Mentha22_contig00010399
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010399 (345 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] 56 6e-06 >emb|CAN80132.1| hypothetical protein VITISV_012031 [Vitis vinifera] Length = 1371 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/42 (57%), Positives = 32/42 (76%) Frame = -3 Query: 133 EMASDLEPILQEFSDVFEEPVGLPPVREVEHQIQLKPQAGAI 8 + +L+ +LQ F+DVFEEP GLPPVR+ +HQI LK +AG I Sbjct: 557 QQQEELQKMLQAFADVFEEPTGLPPVRDYDHQIDLKDEAGPI 598