BLASTX nr result
ID: Mentha22_contig00010091
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010091 (318 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] 77 2e-12 ref|XP_002272882.1| PREDICTED: peroxisome biogenesis protein 7 [... 77 2e-12 emb|CAN72621.1| hypothetical protein VITISV_004948 [Vitis vinifera] 77 2e-12 ref|XP_004293949.1| PREDICTED: peroxisome biogenesis protein 7-l... 77 3e-12 ref|XP_004134658.1| PREDICTED: peroxisome biogenesis protein 7-l... 77 3e-12 ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phas... 76 4e-12 ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-l... 76 4e-12 ref|XP_002317420.2| hypothetical protein POPTR_0011s07330g [Popu... 76 5e-12 ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-l... 75 1e-11 ref|XP_002534414.1| peroxisomal targeting signal 2 receptor, put... 75 1e-11 dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] 75 1e-11 gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus... 74 2e-11 ref|XP_007211636.1| hypothetical protein PRUPE_ppa008638mg [Prun... 74 2e-11 ref|XP_004485898.1| PREDICTED: peroxisome biogenesis protein 7-l... 74 3e-11 ref|XP_002305744.1| peroxisomal targeting signal type 2 receptor... 74 3e-11 ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-l... 72 8e-11 gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] 72 8e-11 ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citr... 69 7e-10 gb|ABK22576.1| unknown [Picea sitchensis] 68 1e-09 gb|ABD91573.1| pectinesterase-like protein [Brassica rapa] 68 1e-09 >gb|EXC24832.1| Peroxisome biogenesis protein 7 [Morus notabilis] Length = 319 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 285 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 319 >ref|XP_002272882.1| PREDICTED: peroxisome biogenesis protein 7 [Vitis vinifera] Length = 316 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >emb|CAN72621.1| hypothetical protein VITISV_004948 [Vitis vinifera] Length = 316 Score = 77.0 bits (188), Expect = 2e-12 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >ref|XP_004293949.1| PREDICTED: peroxisome biogenesis protein 7-like [Fragaria vesca subsp. vesca] Length = 319 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVG+DMSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 285 AVGIDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 319 >ref|XP_004134658.1| PREDICTED: peroxisome biogenesis protein 7-like [Cucumis sativus] gi|449479223|ref|XP_004155540.1| PREDICTED: peroxisome biogenesis protein 7-like [Cucumis sativus] Length = 316 Score = 76.6 bits (187), Expect = 3e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVG+DMSVLVEGLLASTGWDELVYVWQHGTDPRAP Sbjct: 282 AVGIDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 316 >ref|XP_007148045.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] gi|561021268|gb|ESW20039.1| hypothetical protein PHAVU_006G175800g [Phaseolus vulgaris] Length = 318 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGL+ASTGWDELVYVWQHGTDPRAP Sbjct: 284 AVGVDMSVLVEGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_003542988.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X1 [Glycine max] gi|571499880|ref|XP_006594554.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X2 [Glycine max] gi|571499885|ref|XP_006594555.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X3 [Glycine max] gi|571499888|ref|XP_006594556.1| PREDICTED: peroxisome biogenesis protein 7-like isoform X4 [Glycine max] Length = 318 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGL+ASTGWDELVYVWQHGTDPRAP Sbjct: 284 AVGVDMSVLVEGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_002317420.2| hypothetical protein POPTR_0011s07330g [Populus trichocarpa] gi|550327863|gb|EEE98032.2| hypothetical protein POPTR_0011s07330g [Populus trichocarpa] Length = 212 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLV+GLLASTGWDELVYVWQHGTDPRAP Sbjct: 178 AVGVDMSVLVDGLLASTGWDELVYVWQHGTDPRAP 212 >ref|XP_006349215.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGLLASTGWDELVYVWQHG DPRAP Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGMDPRAP 316 >ref|XP_002534414.1| peroxisomal targeting signal 2 receptor, putative [Ricinus communis] gi|223525344|gb|EEF27971.1| peroxisomal targeting signal 2 receptor, putative [Ricinus communis] Length = 318 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGL+ STGWDELVYVWQHGTDPRAP Sbjct: 284 AVGVDMSVLVEGLIGSTGWDELVYVWQHGTDPRAP 318 >dbj|BAH09866.1| peroxin 7 [Nicotiana tabacum] Length = 316 Score = 74.7 bits (182), Expect = 1e-11 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVDMSVLVEGLLASTGWDELVYVWQHG DPRAP Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGMDPRAP 316 >gb|EYU28088.1| hypothetical protein MIMGU_mgv1a010372mg [Mimulus guttatus] Length = 314 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA Sbjct: 280 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 313 >ref|XP_007211636.1| hypothetical protein PRUPE_ppa008638mg [Prunus persica] gi|462407501|gb|EMJ12835.1| hypothetical protein PRUPE_ppa008638mg [Prunus persica] Length = 324 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 313 VGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 VGVDMSVLVEGLLASTGWDEL YVWQHGTDPRAP Sbjct: 291 VGVDMSVLVEGLLASTGWDELAYVWQHGTDPRAP 324 >ref|XP_004485898.1| PREDICTED: peroxisome biogenesis protein 7-like [Cicer arietinum] Length = 318 Score = 73.6 bits (179), Expect = 3e-11 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGL+ASTGWDELVYVWQHGTDPRA Sbjct: 284 AVGVDMSVLVEGLIASTGWDELVYVWQHGTDPRA 317 >ref|XP_002305744.1| peroxisomal targeting signal type 2 receptor family protein [Populus trichocarpa] gi|222848708|gb|EEE86255.1| peroxisomal targeting signal type 2 receptor family protein [Populus trichocarpa] Length = 318 Score = 73.6 bits (179), Expect = 3e-11 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRAP 212 AVGVD+SVLV+GL+ASTGWDELVYVWQHGTDPRAP Sbjct: 284 AVGVDISVLVDGLMASTGWDELVYVWQHGTDPRAP 318 >ref|XP_006366553.1| PREDICTED: peroxisome biogenesis protein 7-like [Solanum tuberosum] Length = 316 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGLLASTGWDELVYVWQHG DPRA Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGMDPRA 315 >gb|AFL46502.1| transcription factor PEX7 [Capsicum annuum] Length = 316 Score = 72.0 bits (175), Expect = 8e-11 Identities = 33/34 (97%), Positives = 33/34 (97%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGLLASTGWDELVYVWQHG DPRA Sbjct: 282 AVGVDMSVLVEGLLASTGWDELVYVWQHGMDPRA 315 >ref|XP_006449507.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] gi|568826569|ref|XP_006467644.1| PREDICTED: peroxisome biogenesis protein 7-like [Citrus sinensis] gi|557552118|gb|ESR62747.1| hypothetical protein CICLE_v10015974mg [Citrus clementina] Length = 317 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/34 (94%), Positives = 32/34 (94%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGLLASTGWDELVYVWQ G DPRA Sbjct: 283 AVGVDMSVLVEGLLASTGWDELVYVWQQGMDPRA 316 >gb|ABK22576.1| unknown [Picea sitchensis] Length = 316 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVG+D+SVLVEGLLASTGWDE VYVWQHG DPRA Sbjct: 282 AVGIDISVLVEGLLASTGWDETVYVWQHGMDPRA 315 >gb|ABD91573.1| pectinesterase-like protein [Brassica rapa] Length = 317 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/34 (91%), Positives = 32/34 (94%) Frame = -3 Query: 316 AVGVDMSVLVEGLLASTGWDELVYVWQHGTDPRA 215 AVGVDMSVLVEGL+ASTGWDELVYVWQ G DPRA Sbjct: 283 AVGVDMSVLVEGLMASTGWDELVYVWQQGMDPRA 316