BLASTX nr result
ID: Mentha22_contig00010052
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010052 (649 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006829087.1| hypothetical protein AMTR_s00001p00261430 [A... 57 6e-06 ref|XP_006360209.1| PREDICTED: transcription factor ASG4-like [S... 56 8e-06 ref|XP_004240716.1| PREDICTED: transcription factor ASG4-like [S... 56 8e-06 >ref|XP_006829087.1| hypothetical protein AMTR_s00001p00261430 [Amborella trichopoda] gi|548834066|gb|ERM96503.1| hypothetical protein AMTR_s00001p00261430 [Amborella trichopoda] Length = 301 Score = 56.6 bits (135), Expect = 6e-06 Identities = 28/58 (48%), Positives = 38/58 (65%) Frame = -3 Query: 473 LFDPSARGQLEELKKMDGIDMETXXXXXXXXXXXLASPEFENHRELLSSYNVQNSYSG 300 +FDP+ G L++LK MD ID+ET L+SPEFE+HR+LLSSY+V +G Sbjct: 224 VFDPNTTGHLQKLKAMDPIDVETVLQLMRNLSVNLSSPEFEDHRKLLSSYDVDTEEAG 281 >ref|XP_006360209.1| PREDICTED: transcription factor ASG4-like [Solanum tuberosum] Length = 358 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 473 LFDPSARGQLEELKKMDGIDMETXXXXXXXXXXXLASPEFENHRELLSSYNVQ 315 +FDP+ G L++LKKMD ID+ET L SP+FE+HR+LLSSY+++ Sbjct: 302 VFDPAVTGHLQKLKKMDRIDVETVLLLMRNLSINLTSPDFEHHRQLLSSYDIE 354 >ref|XP_004240716.1| PREDICTED: transcription factor ASG4-like [Solanum lycopersicum] Length = 301 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/53 (49%), Positives = 37/53 (69%) Frame = -3 Query: 473 LFDPSARGQLEELKKMDGIDMETXXXXXXXXXXXLASPEFENHRELLSSYNVQ 315 +FDP+ G L++LKKMD ID+ET L SP+FE+HR+LLSSY+++ Sbjct: 243 VFDPAVTGHLQKLKKMDRIDVETVLLLMRNLSINLTSPDFEHHRQLLSSYDIE 295