BLASTX nr result
ID: Mentha22_contig00010032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010032 (499 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42978.1| hypothetical protein MIMGU_mgv1a005051mg [Mimulus... 63 5e-08 >gb|EYU42978.1| hypothetical protein MIMGU_mgv1a005051mg [Mimulus guttatus] Length = 499 Score = 62.8 bits (151), Expect = 5e-08 Identities = 39/111 (35%), Positives = 60/111 (54%), Gaps = 1/111 (0%) Frame = +1 Query: 169 MEIISCHAPRSYSVVDFKAVKDLDPHRPKLPFARDKAVSSVAIEPSFVSSRFYHLHNLRT 348 MEIISCH R+ S+ +F+ V DL+ H+ +LP R + + + L LR Sbjct: 1 MEIISCHTARNCSIANFRCVNDLNRHKFELPLTRKVSFYNAI-------GSCFRLDRLRL 53 Query: 349 KNVNRQRVSTTVCSVSRYEDA-AASVMGENYDSYVLDGKRVVVDKVSIPSL 498 +++ R S T+CS+ YE+ +SV+ EN+++Y V KV IPSL Sbjct: 54 SKLDQCRSSRTMCSLDTYENVDDSSVVSENHETY--------VPKVEIPSL 96