BLASTX nr result
ID: Mentha22_contig00010029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00010029 (308 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS69533.1| hypothetical protein M569_05237 [Genlisea aurea] 67 3e-09 >gb|EPS69533.1| hypothetical protein M569_05237 [Genlisea aurea] Length = 159 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/65 (46%), Positives = 42/65 (64%), Gaps = 1/65 (1%) Frame = -2 Query: 259 DFPSNENEKKMSHMIRWNSGKRVDPRLLGMLEVFGEIYVERREFFNKIFHG-DHEEVFKK 83 DFP N IRW SGK VDP+LL +LE FGE+Y +R E F K+F +++++FKK Sbjct: 27 DFPGGVNNPLTEDFIRWKSGKGVDPKLLNLLEQFGELYTDRNELFKKVFKSRNYDDLFKK 86 Query: 82 IGHAL 68 + A+ Sbjct: 87 MSAAM 91