BLASTX nr result
ID: Mentha22_contig00009619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00009619 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus... 61 1e-07 >gb|EYU18652.1| hypothetical protein MIMGU_mgv1a024363mg [Mimulus guttatus] Length = 566 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/61 (42%), Positives = 46/61 (75%), Gaps = 2/61 (3%) Frame = +2 Query: 137 LTTMSSSFQLVTFCFVVLSLSIL--VTNNIYFTINYTRKLHDEFHSVNTYLESLRNTEWL 310 + ++SS ++ TF F++L +++L TN ++FT+NYTR+L++EF +V+ YL +LRN EW Sbjct: 1 MASISSKWKHFTFPFILLFIALLFLATNYVFFTVNYTRQLNEEFQNVSAYLRTLRNPEWF 60 Query: 311 E 313 + Sbjct: 61 D 61