BLASTX nr result
ID: Mentha22_contig00008930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008930 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007151595.1| hypothetical protein PHAVU_004G060200g [Phas... 55 8e-06 >ref|XP_007151595.1| hypothetical protein PHAVU_004G060200g [Phaseolus vulgaris] gi|561024904|gb|ESW23589.1| hypothetical protein PHAVU_004G060200g [Phaseolus vulgaris] Length = 776 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/58 (50%), Positives = 41/58 (70%), Gaps = 3/58 (5%) Frame = +3 Query: 186 RKLVFRNRSL---SQG*KGQWICFVESLKIHSKKRNRLDHKKMHELVYIKYNQKLHKR 350 +KL + SL S G + +W F + IHSKKRNRL+HK++H+LVY+KYNQ+L +R Sbjct: 562 QKLAIKILSLTCSSSGCERKWSVFEQ---IHSKKRNRLEHKRLHDLVYVKYNQQLAQR 616