BLASTX nr result
ID: Mentha22_contig00008760
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008760 (315 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partia... 55 8e-06 >gb|EYU24019.1| hypothetical protein MIMGU_mgv1a0022781mg, partial [Mimulus guttatus] Length = 278 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = +3 Query: 3 LFRKTKATPRIYYLPLSDDVVATKLKSRGKNV 98 LFRKTKA PRIYYLPLSD+ VA KLK++GKN+ Sbjct: 246 LFRKTKAIPRIYYLPLSDEQVAAKLKAQGKNI 277