BLASTX nr result
ID: Mentha22_contig00008624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008624 (524 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22726.1| hypothetical protein MIMGU_mgv1a027152mg [Mimulus... 58 2e-06 >gb|EYU22726.1| hypothetical protein MIMGU_mgv1a027152mg [Mimulus guttatus] Length = 219 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/45 (60%), Positives = 34/45 (75%) Frame = -2 Query: 253 LAISPASHGGRNQCSSRIVATVISDSKVPTTFTVDSAGGGIDILP 119 L++ ++ R Q S + + V+SDSKVPTTFTVDSAGGGIDILP Sbjct: 45 LSVKNPAYAARKQKSFKTITGVVSDSKVPTTFTVDSAGGGIDILP 89