BLASTX nr result
ID: Mentha22_contig00008536
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008536 (418 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Mimulus... 65 7e-09 >gb|EYU38871.1| hypothetical protein MIMGU_mgv1a005433mg [Mimulus guttatus] Length = 484 Score = 65.5 bits (158), Expect = 7e-09 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -2 Query: 417 AWKETMPKEFRKLYGLLRMKSCKRPGSFDHDESEMVER 304 AWKE +PKEFRKLYGLLR+KSC+ PGS D +SEM++R Sbjct: 447 AWKEAVPKEFRKLYGLLRLKSCRTPGSLDQHDSEMIQR 484