BLASTX nr result
ID: Mentha22_contig00008139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008139 (373 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-lik... 64 2e-08 ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-lik... 64 2e-08 ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-lik... 62 6e-08 gb|EYU46000.1| hypothetical protein MIMGU_mgv1a000719mg [Mimulus... 55 8e-06 >ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 1003 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 3 PEKVERVQYLLNISDSTAESLRAMKDKGSPNGAAEEEFVF 122 PEK+ R+QYLL ISDSTAE+LRA+KD+ PNGA EEEFVF Sbjct: 964 PEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1003 >ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 1004 Score = 63.9 bits (154), Expect = 2e-08 Identities = 30/40 (75%), Positives = 35/40 (87%) Frame = +3 Query: 3 PEKVERVQYLLNISDSTAESLRAMKDKGSPNGAAEEEFVF 122 PEK+ R+QYLL ISDSTAE+LRA+KD+ PNGA EEEFVF Sbjct: 965 PEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1004 >ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-like [Solanum lycopersicum] Length = 1005 Score = 62.4 bits (150), Expect = 6e-08 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = +3 Query: 3 PEKVERVQYLLNISDSTAESLRAMKDKGSPNGAAEEEFVF 122 PEK+ R+QYLL ISDSTAE+LR +KD+ PNGA EEEFVF Sbjct: 966 PEKLSRLQYLLGISDSTAETLRTVKDRELPNGAGEEEFVF 1005 >gb|EYU46000.1| hypothetical protein MIMGU_mgv1a000719mg [Mimulus guttatus] Length = 1006 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = +3 Query: 6 EKVERVQYLLNISDSTAESLRAMKDKGSPNGA-AEEEFVF 122 EKV RVQYLL+I+D+ AE+LR KD G PNGA AEEEFVF Sbjct: 967 EKVARVQYLLSINDAAAEALRNAKDNGLPNGAKAEEEFVF 1006