BLASTX nr result
ID: Mentha22_contig00008138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00008138 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-lik... 58 2e-06 ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-lik... 58 2e-06 ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-lik... 56 5e-06 >ref|XP_006361299.1| PREDICTED: protein TIC110, chloroplastic-like isoform X2 [Solanum tuberosum] Length = 1003 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 387 PEKVERVQYLLNINDSTAESLRAMKDKGSPSEAAEEEFVF 268 PEK+ R+QYLL I+DSTAE+LRA+KD+ P+ A EEEFVF Sbjct: 964 PEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1003 >ref|XP_006361298.1| PREDICTED: protein TIC110, chloroplastic-like isoform X1 [Solanum tuberosum] Length = 1004 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/40 (67%), Positives = 34/40 (85%) Frame = -1 Query: 387 PEKVERVQYLLNINDSTAESLRAMKDKGSPSEAAEEEFVF 268 PEK+ R+QYLL I+DSTAE+LRA+KD+ P+ A EEEFVF Sbjct: 965 PEKLSRLQYLLGISDSTAETLRAVKDRELPNGAGEEEFVF 1004 >ref|XP_004246966.1| PREDICTED: protein TIC110, chloroplastic-like [Solanum lycopersicum] Length = 1005 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -1 Query: 387 PEKVERVQYLLNINDSTAESLRAMKDKGSPSEAAEEEFVF 268 PEK+ R+QYLL I+DSTAE+LR +KD+ P+ A EEEFVF Sbjct: 966 PEKLSRLQYLLGISDSTAETLRTVKDRELPNGAGEEEFVF 1005