BLASTX nr result
ID: Mentha22_contig00007383
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00007383 (497 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28219.1| hypothetical protein MIMGU_mgv1a004573mg [Mimulus... 76 5e-12 gb|EYU22784.1| hypothetical protein MIMGU_mgv1a003476mg [Mimulus... 69 9e-10 ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis] 66 4e-09 ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citr... 66 4e-09 ref|XP_004250845.1| PREDICTED: patellin-5-like [Solanum lycopers... 65 1e-08 ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum] 64 2e-08 gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlise... 64 3e-08 ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis] 61 1e-07 ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citr... 61 1e-07 ref|XP_004299816.1| PREDICTED: patellin-3-like [Fragaria vesca s... 61 1e-07 ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum] 61 2e-07 ref|XP_004241867.1| PREDICTED: patellin-5-like [Solanum lycopers... 61 2e-07 ref|XP_004173579.1| PREDICTED: patellin-3-like, partial [Cucumis... 61 2e-07 ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus] 61 2e-07 ref|XP_002525405.1| Patellin-3, putative [Ricinus communis] gi|2... 61 2e-07 dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense] 60 2e-07 ref|XP_007224786.1| hypothetical protein PRUPE_ppa023884mg, part... 60 4e-07 ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Popu... 59 5e-07 ref|XP_006376222.1| hypothetical protein POPTR_0013s11070g [Popu... 59 7e-07 ref|XP_006371458.1| hypothetical protein POPTR_0019s10830g [Popu... 59 7e-07 >gb|EYU28219.1| hypothetical protein MIMGU_mgv1a004573mg [Mimulus guttatus] Length = 520 Score = 75.9 bits (185), Expect = 5e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESNKVDDL+DPEKKALDE KQLI+EALNKHEFT Sbjct: 63 SASFKEESNKVDDLIDPEKKALDEFKQLIQEALNKHEFT 101 >gb|EYU22784.1| hypothetical protein MIMGU_mgv1a003476mg [Mimulus guttatus] Length = 583 Score = 68.6 bits (166), Expect = 9e-10 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESNKVDDL+DPEKKALDELK+LI EAL K EFT Sbjct: 75 SASFKEESNKVDDLIDPEKKALDELKKLIHEALCKREFT 113 >ref|XP_006473247.1| PREDICTED: patellin-2-like [Citrus sinensis] Length = 580 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESN V +L DP+KKALDELKQLI++ALNKHEFT Sbjct: 71 SASFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFT 109 >ref|XP_006434672.1| hypothetical protein CICLE_v10000682mg [Citrus clementina] gi|557536794|gb|ESR47912.1| hypothetical protein CICLE_v10000682mg [Citrus clementina] Length = 582 Score = 66.2 bits (160), Expect = 4e-09 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESN V +L DP+KKALDELKQLI++ALNKHEFT Sbjct: 70 SASFKEESNVVGELPDPQKKALDELKQLIQDALNKHEFT 108 >ref|XP_004250845.1| PREDICTED: patellin-5-like [Solanum lycopersicum] Length = 589 Score = 64.7 bits (156), Expect = 1e-08 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESNKVD+L +PE+KAL ELK+L+++ALNKHEFT Sbjct: 63 SASFKEESNKVDELPNPEQKALAELKELVQDALNKHEFT 101 >ref|XP_006339369.1| PREDICTED: patellin-2-like [Solanum tuberosum] Length = 616 Score = 64.3 bits (155), Expect = 2e-08 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SASFKEESNKV++L +PE+KAL ELKQL+++ALNKHEFT Sbjct: 71 SASFKEESNKVEELPNPEQKALAELKQLVQDALNKHEFT 109 >gb|EPS65885.1| hypothetical protein M569_08890, partial [Genlisea aurea] Length = 554 Score = 63.5 bits (153), Expect = 3e-08 Identities = 30/37 (81%), Positives = 35/37 (94%) Frame = -2 Query: 298 SFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SFKEESNK++DLVDPEKKALDELK LI+EAL+K EF+ Sbjct: 70 SFKEESNKIEDLVDPEKKALDELKLLIQEALDKREFS 106 >ref|XP_006466197.1| PREDICTED: patellin-3-like [Citrus sinensis] Length = 594 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEES +V DL D EKKALDELKQ+++EALNKHEF+ Sbjct: 77 SGSFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFS 115 >ref|XP_006426421.1| hypothetical protein CICLE_v10025217mg [Citrus clementina] gi|557528411|gb|ESR39661.1| hypothetical protein CICLE_v10025217mg [Citrus clementina] Length = 596 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEES +V DL D EKKALDELKQ+++EALNKHEF+ Sbjct: 77 SGSFKEESTRVGDLPDNEKKALDELKQVVQEALNKHEFS 115 >ref|XP_004299816.1| PREDICTED: patellin-3-like [Fragaria vesca subsp. vesca] Length = 603 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEES V +L +P+KKALDELKQLI+EALNKHEFT Sbjct: 71 SVSFKEESYVVGELPEPQKKALDELKQLIQEALNKHEFT 109 >ref|XP_006356506.1| PREDICTED: patellin-2-like [Solanum tuberosum] Length = 577 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEESNKV++L +PE+KAL E KQ+++EALNKHEFT Sbjct: 62 SNSFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFT 100 >ref|XP_004241867.1| PREDICTED: patellin-5-like [Solanum lycopersicum] Length = 580 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/39 (71%), Positives = 35/39 (89%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEESNKV++L +PE+KAL E KQ+++EALNKHEFT Sbjct: 63 SNSFKEESNKVEELPNPEQKALAEFKQMVQEALNKHEFT 101 >ref|XP_004173579.1| PREDICTED: patellin-3-like, partial [Cucumis sativus] Length = 468 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 298 SFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SFKEES KV DL D EKKAL+E KQLI+EALNKHEFT Sbjct: 62 SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEFT 98 >ref|XP_004146380.1| PREDICTED: patellin-3-like [Cucumis sativus] Length = 568 Score = 60.8 bits (146), Expect = 2e-07 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 298 SFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SFKEES KV DL D EKKAL+E KQLI+EALNKHEFT Sbjct: 62 SFKEESTKVADLSDSEKKALEEFKQLIQEALNKHEFT 98 >ref|XP_002525405.1| Patellin-3, putative [Ricinus communis] gi|223535296|gb|EEF36972.1| Patellin-3, putative [Ricinus communis] Length = 606 Score = 60.8 bits (146), Expect = 2e-07 Identities = 28/37 (75%), Positives = 34/37 (91%) Frame = -2 Query: 298 SFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SFKEES KV DL+D EKKA++EL+QL++EALNKHEFT Sbjct: 94 SFKEESTKVADLLDSEKKAVEELRQLVQEALNKHEFT 130 >dbj|BAE71201.1| putative cytosolic factor [Trifolium pratense] Length = 607 Score = 60.5 bits (145), Expect = 2e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEE+N V +L + +KKALDELKQLI+EALNKHEFT Sbjct: 77 SVSFKEETNVVSELPESQKKALDELKQLIQEALNKHEFT 115 >ref|XP_007224786.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica] gi|462421722|gb|EMJ25985.1| hypothetical protein PRUPE_ppa023884mg, partial [Prunus persica] Length = 584 Score = 59.7 bits (143), Expect = 4e-07 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEES V +L +P+KKAL+ELKQLI+EALNKHEFT Sbjct: 40 SVSFKEESYVVGELPEPQKKALEELKQLIQEALNKHEFT 78 >ref|XP_006384383.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa] gi|550340999|gb|ERP62180.1| hypothetical protein POPTR_0004s14530g [Populus trichocarpa] Length = 583 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -2 Query: 298 SFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 SFKEES KV DL+D EKKAL E KQL++EALNKHEF+ Sbjct: 76 SFKEESTKVADLLDSEKKALQEFKQLVQEALNKHEFS 112 >ref|XP_006376222.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa] gi|550325495|gb|ERP54019.1| hypothetical protein POPTR_0013s11070g [Populus trichocarpa] Length = 623 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEE+N V +L + +KKALD+LKQLI+EALNKHEFT Sbjct: 84 SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEFT 122 >ref|XP_006371458.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa] gi|550317248|gb|ERP49255.1| hypothetical protein POPTR_0019s10830g [Populus trichocarpa] Length = 623 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -2 Query: 304 SASFKEESNKVDDLVDPEKKALDELKQLIKEALNKHEFT 188 S SFKEE+N V +L + +KKALD+LKQLI+EALNKHEFT Sbjct: 83 SVSFKEETNVVGELPEAQKKALDDLKQLIQEALNKHEFT 121