BLASTX nr result
ID: Mentha22_contig00006759
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006759 (317 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus... 76 5e-12 gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichoca... 56 6e-06 dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] 55 8e-06 ref|XP_002528469.1| nucleic acid binding protein, putative [Rici... 55 8e-06 >gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus guttatus] Length = 183 Score = 75.9 bits (185), Expect = 5e-12 Identities = 34/38 (89%), Positives = 37/38 (97%) Frame = -3 Query: 273 PIVKKSNSRRVLCLDLNLTPSENKFMFGNVAPAVDCLF 160 PIVKKSNSRRVLC+DLNLTPSENKF+FGNVAPAV+C F Sbjct: 146 PIVKKSNSRRVLCMDLNLTPSENKFLFGNVAPAVNCFF 183 >gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa] Length = 179 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/41 (65%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = -3 Query: 273 PIVKKSNSRRVLCLDLNLTPSENK---FMFGNVAPAVDCLF 160 P+VK+SNSRRVLCLDLNLTP EN F G AP V+C F Sbjct: 139 PVVKRSNSRRVLCLDLNLTPYENDMELFKLGTTAPMVNCFF 179 >dbj|BAA21923.1| ZPT2-14 [Petunia x hybrida] Length = 166 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/40 (70%), Positives = 30/40 (75%), Gaps = 3/40 (7%) Frame = -3 Query: 273 PIVKKSNSRRVLCLDLNLTPSEN---KFMFGNVAPAVDCL 163 P+VKKSNSRRVLCLDLNLTP EN +F G A VDCL Sbjct: 126 PVVKKSNSRRVLCLDLNLTPLENDNLEFKLGKAARIVDCL 165 >ref|XP_002528469.1| nucleic acid binding protein, putative [Ricinus communis] gi|223532145|gb|EEF33952.1| nucleic acid binding protein, putative [Ricinus communis] Length = 190 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 3/39 (7%) Frame = -3 Query: 273 PIVKKSNSRRVLCLDLNLTPSENK---FMFGNVAPAVDC 166 P++KKSNSRRVLCLDLNLTP EN F G AP VDC Sbjct: 150 PVMKKSNSRRVLCLDLNLTPYENDVELFRLGKTAPMVDC 188