BLASTX nr result
ID: Mentha22_contig00006758
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006758 (316 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus... 75 7e-12 ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12-like [V... 58 1e-06 gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichoca... 55 8e-06 >gb|EYU19898.1| hypothetical protein MIMGU_mgv1a014646mg [Mimulus guttatus] Length = 183 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/38 (86%), Positives = 37/38 (97%) Frame = -3 Query: 299 PIVKKSNSRRILCLDLNLTPSENKFMFGNVAPAVDCLF 186 PIVKKSNSRR+LC+DLNLTPSENKF+FGNVAPAV+C F Sbjct: 146 PIVKKSNSRRVLCMDLNLTPSENKFLFGNVAPAVNCFF 183 >ref|XP_002284111.1| PREDICTED: zinc finger protein ZAT12-like [Vitis vinifera] Length = 176 Score = 58.2 bits (139), Expect = 1e-06 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 3/43 (6%) Frame = -3 Query: 311 PPFAPIVKKSNSRRILCLDLNLTPSEN---KFMFGNVAPAVDC 192 PP AP++KK NSRR+LCLDLNLTP EN +F G VA VDC Sbjct: 132 PPQAPLLKKPNSRRVLCLDLNLTPLENIDLQFQLGKVASMVDC 174 >gb|AES12473.1| C2H2-type zinc finger protein 1 [Populus trichocarpa] Length = 179 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 3/41 (7%) Frame = -3 Query: 299 PIVKKSNSRRILCLDLNLTPSENK---FMFGNVAPAVDCLF 186 P+VK+SNSRR+LCLDLNLTP EN F G AP V+C F Sbjct: 139 PVVKRSNSRRVLCLDLNLTPYENDMELFKLGTTAPMVNCFF 179