BLASTX nr result
ID: Mentha22_contig00006713
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006713 (635 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU18130.1| hypothetical protein MIMGU_mgv1a012830mg [Mimulus... 82 1e-13 gb|EYU18129.1| hypothetical protein MIMGU_mgv1a012715mg [Mimulus... 72 2e-10 dbj|BAD11071.1| hin1 like protein [Capsicum chinense] 64 5e-08 ref|NP_196250.1| NDR1/HIN1-Like protein 3 [Arabidopsis thaliana]... 62 2e-07 gb|AAK44147.2|AF370332_1 putative harpin-induced protein [Arabid... 62 2e-07 gb|AAF88023.1|AF264699_1 NDR1/HIN1-like protein 3 [Arabidopsis t... 62 2e-07 dbj|BAD22533.1| harpin inducing protein 1-like 9 [Nicotiana taba... 61 2e-07 ref|XP_002873248.1| hypothetical protein ARALYDRAFT_908556 [Arab... 61 2e-07 dbj|BAD22534.1| harpin inducing protein 1-like 18 [Nicotiana tab... 58 2e-06 emb|CAA68848.1| hin1 [Nicotiana tabacum] 57 4e-06 gb|AAF62403.1|AF212183_1 harpin inducing protein [Nicotiana taba... 57 4e-06 ref|XP_004249411.1| PREDICTED: putative syntaxin-24-like [Solanu... 56 8e-06 >gb|EYU18130.1| hypothetical protein MIMGU_mgv1a012830mg [Mimulus guttatus] Length = 239 Score = 82.0 bits (201), Expect = 1e-13 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 2/47 (4%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASA--VYEPTRCDFDWR 136 IR+KF FVKS RVKPKIDCDLKIPL SNGTASA VYEP RCDFDWR Sbjct: 193 IRLKFRFVKSWRVKPKIDCDLKIPLTSNGTASASGVYEPERCDFDWR 239 >gb|EYU18129.1| hypothetical protein MIMGU_mgv1a012715mg [Mimulus guttatus] Length = 242 Score = 71.6 bits (174), Expect = 2e-10 Identities = 32/46 (69%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTAS-AVYEPTRCDFDWR 136 IR+KF F+KSS+VKPKIDCDL+IPL SN TA+ A ++ RCDFDWR Sbjct: 197 IRLKFVFLKSSKVKPKIDCDLRIPLSSNATAAPAAFQSQRCDFDWR 242 >dbj|BAD11071.1| hin1 like protein [Capsicum chinense] Length = 228 Score = 63.5 bits (153), Expect = 5e-08 Identities = 24/44 (54%), Positives = 36/44 (81%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR+K ++K+ ++KPKI+CD+K+PL+SNG +SA +E TRC DW Sbjct: 185 IRLKIGWIKTHKIKPKIECDIKVPLESNGRSSANFEETRCHLDW 228 >ref|NP_196250.1| NDR1/HIN1-Like protein 3 [Arabidopsis thaliana] gi|9758412|dbj|BAB08954.1| harpin-induced protein-like [Arabidopsis thaliana] gi|24030178|gb|AAN41271.1| putative harpin-induced protein [Arabidopsis thaliana] gi|332003619|gb|AED91002.1| NDR1/HIN1-Like protein 3 [Arabidopsis thaliana] Length = 231 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR KF +KS R KPKI CDLK+PL SN T+ V++PT+CD D+ Sbjct: 188 IRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSGFVFQPTKCDVDF 231 >gb|AAK44147.2|AF370332_1 putative harpin-induced protein [Arabidopsis thaliana] Length = 223 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR KF +KS R KPKI CDLK+PL SN T+ V++PT+CD D+ Sbjct: 180 IRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSGFVFQPTKCDVDF 223 >gb|AAF88023.1|AF264699_1 NDR1/HIN1-like protein 3 [Arabidopsis thaliana] gi|24417302|gb|AAN60261.1| unknown [Arabidopsis thaliana] Length = 230 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/44 (59%), Positives = 33/44 (75%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR KF +KS R KPKI CDLK+PL SN T+ V++PT+CD D+ Sbjct: 187 IRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSGFVFQPTKCDVDF 230 >dbj|BAD22533.1| harpin inducing protein 1-like 9 [Nicotiana tabacum] Length = 229 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/45 (55%), Positives = 37/45 (82%), Gaps = 1/45 (2%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNG-TASAVYEPTRCDFDW 133 IR+KF ++K+ ++KPKI+CD K+PL+SNG ++SA +E TRC DW Sbjct: 185 IRLKFGWIKTRKIKPKIECDFKVPLESNGRSSSANFEETRCHLDW 229 >ref|XP_002873248.1| hypothetical protein ARALYDRAFT_908556 [Arabidopsis lyrata subsp. lyrata] gi|297319085|gb|EFH49507.1| hypothetical protein ARALYDRAFT_908556 [Arabidopsis lyrata subsp. lyrata] Length = 231 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR KF +KS R KPK+ CDLK+PL SN T+ V++PT+CD D+ Sbjct: 188 IRFKFGLIKSWRFKPKVKCDLKVPLTSNSTSGFVFQPTKCDVDF 231 >dbj|BAD22534.1| harpin inducing protein 1-like 18 [Nicotiana tabacum] Length = 229 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/45 (53%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNG-TASAVYEPTRCDFDW 133 IR+K ++K+ ++KPKI+CD K+PL+SNG ++SA +E TRC DW Sbjct: 185 IRLKAGWIKTHKIKPKIECDFKVPLESNGRSSSANFEETRCHLDW 229 >emb|CAA68848.1| hin1 [Nicotiana tabacum] Length = 221 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/45 (53%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNG-TASAVYEPTRCDFDW 133 IR+K ++K+ ++KPKI+CD K+PL SNG ++SA +E TRC DW Sbjct: 177 IRLKVGWIKTHKIKPKIECDFKVPLGSNGRSSSANFEETRCHLDW 221 >gb|AAF62403.1|AF212183_1 harpin inducing protein [Nicotiana tabacum] gi|22830759|dbj|BAC15623.1| hin1 [Nicotiana tabacum] Length = 229 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/45 (53%), Positives = 35/45 (77%), Gaps = 1/45 (2%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNG-TASAVYEPTRCDFDW 133 IR+K ++K+ ++KPKI+CD K+PL SNG ++SA +E TRC DW Sbjct: 185 IRLKVGWIKTHKIKPKIECDFKVPLGSNGRSSSANFEETRCHLDW 229 >ref|XP_004249411.1| PREDICTED: putative syntaxin-24-like [Solanum lycopersicum] Length = 231 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/44 (52%), Positives = 33/44 (75%) Frame = +2 Query: 2 IRMKFAFVKSSRVKPKIDCDLKIPLKSNGTASAVYEPTRCDFDW 133 IR+K ++K+ ++KPKI+CD K+PL+SNG S +E TRC DW Sbjct: 189 IRLKIGWIKTHKIKPKIECDFKVPLESNG-RSGNFEETRCHLDW 231