BLASTX nr result
ID: Mentha22_contig00006699
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006699 (332 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43414.1| hypothetical protein MIMGU_mgv1a006364mg [Mimulus... 65 8e-09 ref|XP_006361038.1| PREDICTED: trafficking protein particle comp... 57 2e-06 ref|XP_004248116.1| PREDICTED: UPF0533 protein C5orf44 homolog [... 57 2e-06 >gb|EYU43414.1| hypothetical protein MIMGU_mgv1a006364mg [Mimulus guttatus] Length = 447 Score = 65.5 bits (158), Expect = 8e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = -3 Query: 330 KHGIQKISGITVFDTVEKKTYESLFELEIYVDLE 229 KHGIQKISGITV+DT+EKKTY+SL ELEIYVDLE Sbjct: 414 KHGIQKISGITVYDTIEKKTYDSLLELEIYVDLE 447 >ref|XP_006361038.1| PREDICTED: trafficking protein particle complex subunit 13-like [Solanum tuberosum] Length = 449 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 330 KHGIQKISGITVFDTVEKKTYESLFELEIYVD 235 KHG+QKI+GITVFDT EKKTY+SL ELE++VD Sbjct: 416 KHGVQKITGITVFDTREKKTYDSLLELEVFVD 447 >ref|XP_004248116.1| PREDICTED: UPF0533 protein C5orf44 homolog [Solanum lycopersicum] Length = 446 Score = 57.4 bits (137), Expect = 2e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -3 Query: 330 KHGIQKISGITVFDTVEKKTYESLFELEIYVD 235 KHG+QKI+GITVFDT EKKTY+SL ELE++VD Sbjct: 413 KHGVQKITGITVFDTREKKTYDSLLELEVFVD 444