BLASTX nr result
ID: Mentha22_contig00006276
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00006276 (361 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_008992358.1| hypothetical protein Salmi_Mp093 (mitochondr... 56 6e-06 >ref|YP_008992358.1| hypothetical protein Salmi_Mp093 (mitochondrion) [Salvia miltiorrhiza] gi|534292329|gb|AGU16621.1| hypothetical protein Salmi_Mp093 (mitochondrion) [Salvia miltiorrhiza] Length = 281 Score = 55.8 bits (133), Expect = 6e-06 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +1 Query: 142 PQGKLLSPRTYGSYVTQIREHGTRLSVPYRRVIRAVENYDLLLER 276 P G LLS RTY S++ QI+E+GTR S+PY+R++ A++ DLLLER Sbjct: 237 PYGGLLSSRTYQSHIRQIQENGTRSSLPYQRLMIAIDKSDLLLER 281