BLASTX nr result
ID: Mentha22_contig00005971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00005971 (416 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, en... 62 8e-08 ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein... 61 1e-07 ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transport... 60 3e-07 ref|XP_002510078.1| cation-transporting atpase, putative [Ricinu... 60 3e-07 gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus... 59 7e-07 ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, en... 58 1e-06 gb|ACJ86234.1| unknown [Medicago truncatula] 58 1e-06 ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, en... 58 2e-06 ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, en... 57 3e-06 ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, en... 56 5e-06 ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [A... 56 6e-06 >ref|XP_004501511.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Cicer arietinum] Length = 1005 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDEILKFFSR+ G RF L RRSDLLPKREVRDK Sbjct: 968 VIIIDEILKFFSRNPNGLRFRLWFRRSDLLPKREVRDK 1005 >ref|XP_002320682.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] gi|222861455|gb|EEE98997.1| Calcium-transporting ATPase 3 family protein [Populus trichocarpa] Length = 1015 Score = 61.2 bits (147), Expect = 1e-07 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDEILKFFSR+S G R LR RR DLLPKRE+RDK Sbjct: 978 VIIIDEILKFFSRNSTGLRLGLRFRRPDLLPKRELRDK 1015 >ref|XP_007018465.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] gi|508723793|gb|EOY15690.1| Endoplasmic reticulum-type calcium-transporting ATPase 3 isoform 1 [Theobroma cacao] Length = 1001 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDE+LKFFSR+S G RFN R RR D LPK+E+RDK Sbjct: 964 VIIIDEVLKFFSRNSYGIRFNFRFRRFDALPKKELRDK 1001 >ref|XP_002510078.1| cation-transporting atpase, putative [Ricinus communis] gi|223550779|gb|EEF52265.1| cation-transporting atpase, putative [Ricinus communis] Length = 987 Score = 60.1 bits (144), Expect = 3e-07 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDEILKFFSR++ G RF R RR DLLPKRE RDK Sbjct: 950 VIIIDEILKFFSRNANGIRFRFRFRRPDLLPKRESRDK 987 >gb|EYU36392.1| hypothetical protein MIMGU_mgv1a000823mg [Mimulus guttatus] Length = 971 Score = 58.9 bits (141), Expect = 7e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VI+IDEILKFFSR+ G RFN R RR+DLLPK+EV D+ Sbjct: 934 VILIDEILKFFSRNPTGLRFNFRFRRTDLLPKQEVHDR 971 >ref|XP_004242949.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Solanum lycopersicum] Length = 1000 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VI+IDEILKFFSR S G RF+ R RR+DLLPKRE+RDK Sbjct: 964 VILIDEILKFFSRHS-GIRFSFRFRRADLLPKREIRDK 1000 >gb|ACJ86234.1| unknown [Medicago truncatula] Length = 413 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/38 (76%), Positives = 31/38 (81%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDEILKFFSR+ G R L RR+DLLPKREVRDK Sbjct: 376 VIIIDEILKFFSRNPSGLRLRLWFRRTDLLPKREVRDK 413 >ref|XP_003524018.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoformX1 [Glycine max] Length = 1001 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VI+IDE+LKFFSR+ G RF L RRSDLLPK+E+RDK Sbjct: 964 VIVIDEVLKFFSRNPIGLRFRLWFRRSDLLPKKELRDK 1001 >ref|XP_004290983.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like [Fragaria vesca subsp. vesca] Length = 1001 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDE+LKFFSR + G R N LRR DLLP++E+RDK Sbjct: 964 VIIIDEVLKFFSRSTTGLRLNFLLRRHDLLPRKELRDK 1001 >ref|XP_006347865.1| PREDICTED: calcium-transporting ATPase 3, endoplasmic reticulum-type-like isoform X1 [Solanum tuberosum] Length = 1000 Score = 56.2 bits (134), Expect = 5e-06 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VI+IDEILKF SR+S G RF+ R RR+DLLPKRE+RDK Sbjct: 964 VILIDEILKFVSRNS-GIRFSFRFRRADLLPKREIRDK 1000 >ref|XP_006857120.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] gi|548861203|gb|ERN18587.1| hypothetical protein AMTR_s00065p00134450 [Amborella trichopoda] Length = 1001 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +3 Query: 3 VIIIDEILKFFSRDSRGFRFNLRLRRSDLLPKREVRDK 116 VIIIDEILK SR+ RG RFNLR + DLLPKRE+RD+ Sbjct: 964 VIIIDEILKLLSRNVRGRRFNLRFGKRDLLPKREIRDR 1001