BLASTX nr result
ID: Mentha22_contig00005042
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00005042 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial... 80 2e-13 >gb|EYU19288.1| hypothetical protein MIMGU_mgv1a022146mg, partial [Mimulus guttatus] Length = 687 Score = 80.5 bits (197), Expect = 2e-13 Identities = 42/58 (72%), Positives = 48/58 (82%), Gaps = 1/58 (1%) Frame = +1 Query: 1 LVEESVNLLPEVLQQQLKTGNLPEVAVFDGNQNIPPKSNL-PTVQEPILGNLLFRAPQ 171 LV +SV+LLP+VLQQQLK+GNLPEV VF N+NI KSN TVQEPILGNLLF AP+ Sbjct: 630 LVGQSVDLLPDVLQQQLKSGNLPEVGVFPNNENISVKSNFGATVQEPILGNLLFNAPK 687