BLASTX nr result
ID: Mentha22_contig00002953
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00002953 (405 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus... 61 2e-07 >gb|EYU22855.1| hypothetical protein MIMGU_mgv1a010065mg [Mimulus guttatus] Length = 323 Score = 60.8 bits (146), Expect = 2e-07 Identities = 42/94 (44%), Positives = 53/94 (56%), Gaps = 2/94 (2%) Frame = +3 Query: 129 MLIHYS-SPPSQQCESTAIFVSSLKPRNKFQCPNSYHFSIVSSNEASLFCLSRKPTK-KF 302 M+I S SPP Q C TAIF+ +PRN P S F NE SL SRKPTK KF Sbjct: 1 MIIQCSFSPPLQHCFRTAIFI---RPRNNPHSPISCAF-----NEKSLLFFSRKPTKLKF 52 Query: 303 RIPKLSLPVLGKEGRSSSPLTLRKIEDVPRKLLI 404 +P+ SL VL K+ S S TL ++E+ K+ + Sbjct: 53 TVPRFSLQVLKKKNESCSSSTLTEVEEASWKVSV 86