BLASTX nr result
ID: Mentha22_contig00002861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00002861 (503 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32126.1| hypothetical protein MIMGU_mgv1a001191mg [Mimulus... 82 8e-14 gb|EXB30880.1| U-box domain-containing protein 33 [Morus notabilis] 77 3e-12 gb|EPS70423.1| hypothetical protein M569_04335 [Genlisea aurea] 75 1e-11 ref|XP_007220262.1| hypothetical protein PRUPE_ppa001267mg [Prun... 75 1e-11 ref|XP_002511867.1| receptor protein kinase, putative [Ricinus c... 74 2e-11 ref|XP_004306778.1| PREDICTED: U-box domain-containing protein 3... 74 2e-11 ref|XP_004166237.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain... 72 6e-11 ref|XP_004140834.1| PREDICTED: U-box domain-containing protein 3... 72 6e-11 ref|XP_002511869.1| receptor protein kinase, putative [Ricinus c... 72 1e-10 ref|XP_006339578.1| PREDICTED: U-box domain-containing protein 3... 71 2e-10 ref|XP_006827592.1| hypothetical protein AMTR_s00009p00235710 [A... 71 2e-10 ref|XP_004229888.1| PREDICTED: U-box domain-containing protein 3... 71 2e-10 ref|XP_002274993.2| PREDICTED: U-box domain-containing protein 3... 71 2e-10 ref|XP_002513684.1| receptor protein kinase, putative [Ricinus c... 71 2e-10 emb|CAN67166.1| hypothetical protein VITISV_015820 [Vitis vinifera] 71 2e-10 gb|EXC19150.1| U-box domain-containing protein 32 [Morus notabilis] 70 2e-10 ref|XP_002301358.2| U-box domain-containing family protein [Popu... 70 2e-10 ref|XP_007038733.1| Receptor protein kinase, putative isoform 2 ... 70 2e-10 ref|XP_007038732.1| U-box domain-containing protein kinase famil... 70 2e-10 gb|ABK95716.1| unknown [Populus trichocarpa] 70 2e-10 >gb|EYU32126.1| hypothetical protein MIMGU_mgv1a001191mg [Mimulus guttatus] Length = 869 Score = 82.0 bits (201), Expect = 8e-14 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 LKGWLESGHDTSPMTNLKLP+CNLVPNH LRSAIQEW Q Sbjct: 829 LKGWLESGHDTSPMTNLKLPNCNLVPNHALRSAIQEWLQQ 868 >gb|EXB30880.1| U-box domain-containing protein 33 [Morus notabilis] Length = 874 Score = 76.6 bits (187), Expect = 3e-12 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L+GWL+SGHDTSPMTN KL HCNLVPNH LRSAIQEW Q Sbjct: 834 LRGWLDSGHDTSPMTNHKLEHCNLVPNHALRSAIQEWLQQ 873 >gb|EPS70423.1| hypothetical protein M569_04335 [Genlisea aurea] Length = 700 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEW 113 LKGWLESGHDTSPMTNLKLP+ +LVPNH LRSAIQEW Sbjct: 660 LKGWLESGHDTSPMTNLKLPNTDLVPNHALRSAIQEW 696 >ref|XP_007220262.1| hypothetical protein PRUPE_ppa001267mg [Prunus persica] gi|462416724|gb|EMJ21461.1| hypothetical protein PRUPE_ppa001267mg [Prunus persica] Length = 867 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L+GWL+SGHDTSPMTNLKL H NLVPNH LRSAIQEW Q Sbjct: 827 LRGWLDSGHDTSPMTNLKLEHKNLVPNHALRSAIQEWLQQ 866 >ref|XP_002511867.1| receptor protein kinase, putative [Ricinus communis] gi|223549047|gb|EEF50536.1| receptor protein kinase, putative [Ricinus communis] Length = 309 Score = 74.3 bits (181), Expect = 2e-11 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEW 113 L+GWL+SGHDTSPMTNLKL H NLVPNH LRSAIQEW Sbjct: 269 LRGWLDSGHDTSPMTNLKLAHSNLVPNHALRSAIQEW 305 >ref|XP_004306778.1| PREDICTED: U-box domain-containing protein 33-like [Fragaria vesca subsp. vesca] Length = 889 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/40 (80%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L+GW++SGHDTSPMTNLKL H NLVPNH LRSAIQEW Q Sbjct: 849 LRGWMDSGHDTSPMTNLKLEHKNLVPNHALRSAIQEWLQQ 888 >ref|XP_004166237.1| PREDICTED: LOW QUALITY PROTEIN: U-box domain-containing protein 32-like [Cucumis sativus] Length = 926 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GW +SGH+TSPMTNLKL HCNLVPN+ L +AIQEW HQ Sbjct: 886 IRGWFKSGHNTSPMTNLKLEHCNLVPNYALLNAIQEWQHQ 925 >ref|XP_004140834.1| PREDICTED: U-box domain-containing protein 32-like [Cucumis sativus] Length = 909 Score = 72.4 bits (176), Expect = 6e-11 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GW +SGH+TSPMTNLKL HCNLVPN+ L +AIQEW HQ Sbjct: 869 IRGWFKSGHNTSPMTNLKLEHCNLVPNYALLNAIQEWQHQ 908 >ref|XP_002511869.1| receptor protein kinase, putative [Ricinus communis] gi|223549049|gb|EEF50538.1| receptor protein kinase, putative [Ricinus communis] Length = 742 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/40 (80%), Positives = 33/40 (82%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L GWLESGH+TSPMTNL LPH NLVPN LRSAIQEW Q Sbjct: 702 LTGWLESGHNTSPMTNLVLPHLNLVPNRALRSAIQEWQQQ 741 >ref|XP_006339578.1| PREDICTED: U-box domain-containing protein 33-like isoform X1 [Solanum tuberosum] gi|565344983|ref|XP_006339579.1| PREDICTED: U-box domain-containing protein 33-like isoform X2 [Solanum tuberosum] Length = 892 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L+GWL+SGH+TSPMTNL L H NLVPNH LRSAIQEW Q Sbjct: 852 LRGWLDSGHETSPMTNLTLSHKNLVPNHALRSAIQEWLQQ 891 >ref|XP_006827592.1| hypothetical protein AMTR_s00009p00235710 [Amborella trichopoda] gi|548832212|gb|ERM95008.1| hypothetical protein AMTR_s00009p00235710 [Amborella trichopoda] Length = 872 Score = 70.9 bits (172), Expect = 2e-10 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEW 113 L+GW ES HDTSPMTNLKLPH NL+PN LRSAIQEW Sbjct: 833 LRGWFESDHDTSPMTNLKLPHLNLIPNRALRSAIQEW 869 >ref|XP_004229888.1| PREDICTED: U-box domain-containing protein 33-like [Solanum lycopersicum] Length = 894 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 L+GWL+SGH+TSPMTNL L H NLVPNH LRSAIQEW Q Sbjct: 854 LRGWLDSGHETSPMTNLTLSHKNLVPNHALRSAIQEWLQQ 893 >ref|XP_002274993.2| PREDICTED: U-box domain-containing protein 33-like [Vitis vinifera] gi|297745303|emb|CBI40383.3| unnamed protein product [Vitis vinifera] Length = 881 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQP 125 L+GWL+ GH TSPMTNLKL H NLVPN LRSAIQEW QP Sbjct: 841 LRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQP 881 >ref|XP_002513684.1| receptor protein kinase, putative [Ricinus communis] gi|223547592|gb|EEF49087.1| receptor protein kinase, putative [Ricinus communis] Length = 793 Score = 70.9 bits (172), Expect = 2e-10 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GWL+SGH+TSPMTNLKL HCNL+PNH L AIQEW + Sbjct: 753 IRGWLKSGHNTSPMTNLKLEHCNLLPNHALHQAIQEWQQR 792 >emb|CAN67166.1| hypothetical protein VITISV_015820 [Vitis vinifera] Length = 881 Score = 70.9 bits (172), Expect = 2e-10 Identities = 31/41 (75%), Positives = 33/41 (80%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQP 125 L+GWL+ GH TSPMTNLKL H NLVPN LRSAIQEW QP Sbjct: 841 LRGWLDGGHSTSPMTNLKLGHLNLVPNRALRSAIQEWLQQP 881 >gb|EXC19150.1| U-box domain-containing protein 32 [Morus notabilis] Length = 598 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GWL SGH+TSPMTNLKL HCNLVPN+ L++AIQEW Q Sbjct: 558 IRGWLHSGHNTSPMTNLKLDHCNLVPNYALQNAIQEWQLQ 597 >ref|XP_002301358.2| U-box domain-containing family protein [Populus trichocarpa] gi|550345130|gb|EEE80631.2| U-box domain-containing family protein [Populus trichocarpa] Length = 836 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 LKGWL+SGHDTSPMTNLKL H +L+PN LRSAIQEW Q Sbjct: 796 LKGWLDSGHDTSPMTNLKLAHRDLIPNRALRSAIQEWLQQ 835 >ref|XP_007038733.1| Receptor protein kinase, putative isoform 2 [Theobroma cacao] gi|508775978|gb|EOY23234.1| Receptor protein kinase, putative isoform 2 [Theobroma cacao] Length = 705 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GWLESGHD SPMTNLKL HC+LVPN+ L AIQEW Q Sbjct: 665 IRGWLESGHDRSPMTNLKLEHCSLVPNYALHQAIQEWQQQ 704 >ref|XP_007038732.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508775977|gb|EOY23233.1| U-box domain-containing protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 801 Score = 70.5 bits (171), Expect = 2e-10 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 ++GWLESGHD SPMTNLKL HC+LVPN+ L AIQEW Q Sbjct: 761 IRGWLESGHDRSPMTNLKLEHCSLVPNYALHQAIQEWQQQ 800 >gb|ABK95716.1| unknown [Populus trichocarpa] Length = 521 Score = 70.5 bits (171), Expect = 2e-10 Identities = 31/40 (77%), Positives = 34/40 (85%) Frame = +3 Query: 3 LKGWLESGHDTSPMTNLKLPHCNLVPNHTLRSAIQEWSHQ 122 LKGWL+SGHDTSPMTNLKL H +L+PN LRSAIQEW Q Sbjct: 481 LKGWLDSGHDTSPMTNLKLAHRDLIPNRALRSAIQEWLQQ 520