BLASTX nr result
ID: Mentha22_contig00002124
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00002124 (439 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU29676.1| hypothetical protein MIMGU_mgv1a027108mg [Mimulus... 61 1e-07 >gb|EYU29676.1| hypothetical protein MIMGU_mgv1a027108mg [Mimulus guttatus] Length = 161 Score = 61.2 bits (147), Expect = 1e-07 Identities = 31/46 (67%), Positives = 32/46 (69%), Gaps = 5/46 (10%) Frame = -1 Query: 295 MCPTGSEL-----SRTVEKSNLRSAFDVLDADGDGRISHADLRAFY 173 MCPTGS + R KSNLRSAFDVLD DGDGRIS DLR FY Sbjct: 1 MCPTGSSILENGNKRAAPKSNLRSAFDVLDVDGDGRISRDDLRTFY 46