BLASTX nr result
ID: Mentha22_contig00001273
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00001273 (442 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU43861.1| hypothetical protein MIMGU_mgv1a013946mg [Mimulus... 61 1e-07 >gb|EYU43861.1| hypothetical protein MIMGU_mgv1a013946mg [Mimulus guttatus] Length = 205 Score = 61.2 bits (147), Expect = 1e-07 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +1 Query: 271 MGTEVLYQQDLLAQRLHVAPPSYHRRRYYPSSGNLTNVVVNRRPSQKVN 417 MGTEVL QDLL +R HV P S+HRRR +P++G ++N+ +NR+P+ N Sbjct: 1 MGTEVLRPQDLLVERFHVPPASFHRRRNFPATGAISNLNINRKPNHTPN 49