BLASTX nr result
ID: Mentha22_contig00000916
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00000916 (303 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU31806.1| hypothetical protein MIMGU_mgv1a0039951mg, partia... 62 6e-08 >gb|EYU31806.1| hypothetical protein MIMGU_mgv1a0039951mg, partial [Mimulus guttatus] Length = 101 Score = 62.4 bits (150), Expect = 6e-08 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +3 Query: 162 QRLQSHRA---STIRTKPLRKTCRIVSSTGEPLKVMISGAPASGKGTQCE 302 Q+L H A + IR K RK +IVSS GEPLKVMISGAPASGKGTQCE Sbjct: 47 QQLSPHNAYGIAGIRNKYARKVPKIVSSKGEPLKVMISGAPASGKGTQCE 96