BLASTX nr result
ID: Mentha22_contig00000748
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00000748 (438 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein i... 55 8e-06 ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein i... 55 8e-06 >ref|XP_007021317.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] gi|508720945|gb|EOY12842.1| Peroxisomal membrane 22 kDa family protein isoform 3 [Theobroma cacao] Length = 391 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 436 WVTILSTYSNEKSEARISEAPAEAIAGLPP 347 WVTILSTYSNEKSEARI+EAPAEA + LPP Sbjct: 352 WVTILSTYSNEKSEARIAEAPAEANSSLPP 381 >ref|XP_007021315.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|590608627|ref|XP_007021316.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720943|gb|EOY12840.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] gi|508720944|gb|EOY12841.1| Peroxisomal membrane 22 kDa family protein isoform 1 [Theobroma cacao] Length = 386 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 436 WVTILSTYSNEKSEARISEAPAEAIAGLPP 347 WVTILSTYSNEKSEARI+EAPAEA + LPP Sbjct: 347 WVTILSTYSNEKSEARIAEAPAEANSSLPP 376