BLASTX nr result
ID: Mentha22_contig00000625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Mentha22_contig00000625 (591 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU42618.1| hypothetical protein MIMGU_mgv1a015312mg [Mimulus... 66 6e-09 ref|XP_004230959.1| PREDICTED: AP-3 complex subunit sigma-like [... 62 1e-07 ref|XP_006365104.1| PREDICTED: AP-3 complex subunit sigma-like [... 61 3e-07 >gb|EYU42618.1| hypothetical protein MIMGU_mgv1a015312mg [Mimulus guttatus] Length = 161 Score = 66.2 bits (160), Expect = 6e-09 Identities = 34/46 (73%), Positives = 38/46 (82%) Frame = +1 Query: 1 ILDEIILGGQVLETSSEEVANAVDAISRMEKNANSYMPAIPGWQGR 138 ILDEIILGGQVLETSS EV AV+ IS+ME+NANS +PA WQGR Sbjct: 118 ILDEIILGGQVLETSSSEVVKAVEEISKMERNANSILPA--SWQGR 161 >ref|XP_004230959.1| PREDICTED: AP-3 complex subunit sigma-like [Solanum lycopersicum] Length = 165 Score = 62.0 bits (149), Expect = 1e-07 Identities = 33/48 (68%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +1 Query: 1 ILDEIILGGQVLETSSEEVANAVDAISRMEKNANSYM--PAIPGWQGR 138 ILDEIILGGQVLETSS EV AV+ I +ME+ ANS M P+I WQGR Sbjct: 118 ILDEIILGGQVLETSSSEVVKAVEEIYKMERAANSIMAVPSITSWQGR 165 >ref|XP_006365104.1| PREDICTED: AP-3 complex subunit sigma-like [Solanum tuberosum] Length = 165 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/48 (66%), Positives = 37/48 (77%), Gaps = 2/48 (4%) Frame = +1 Query: 1 ILDEIILGGQVLETSSEEVANAVDAISRMEKNANSYM--PAIPGWQGR 138 ILDEIILGG+VLETSS EV AV+ I +ME+ ANS M P+I WQGR Sbjct: 118 ILDEIILGGEVLETSSSEVVKAVEEIYKMERAANSIMAVPSITSWQGR 165