BLASTX nr result
ID: Magnolia22_contig00037868
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037868 (664 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018040624.1 family A G protein-coupled receptor-like protein ... 124 2e-30 GAM85256.1 hypothetical protein ANO11243_032600 [fungal sp. No.1... 120 2e-29 EME38958.1 hypothetical protein DOTSEDRAFT_75607 [Dothistroma se... 119 5e-29 XP_008030750.1 hypothetical protein SETTUDRAFT_165763 [Setosphae... 117 2e-28 XP_016756173.1 family A G protein-coupled receptor-like protein ... 117 6e-28 XP_003838475.1 hypothetical protein LEMA_P114110.1 [Leptosphaeri... 116 6e-28 XP_014561228.1 hypothetical protein COCVIDRAFT_87288 [Bipolaris ... 116 6e-28 XP_007712526.1 hypothetical protein COCCADRAFT_26476 [Bipolaris ... 116 6e-28 XP_007685632.1 hypothetical protein COCMIDRAFT_88800 [Bipolaris ... 115 2e-27 XP_007698250.1 hypothetical protein COCSADRAFT_25007 [Bipolaris ... 115 2e-27 XP_014083612.1 hypothetical protein COCC4DRAFT_184935 [Bipolaris... 115 2e-27 XP_007922601.1 hypothetical protein MYCFIDRAFT_56178 [Pseudocerc... 114 4e-27 XP_003847675.1 hypothetical protein MYCGRDRAFT_106573 [Zymosepto... 114 5e-27 KJY02165.1 family A G protein-coupled receptor-like protein [Zym... 114 6e-27 KXT13595.1 hypothetical protein AC579_8497 [Pseudocercospora musae] 113 1e-26 KXS96415.1 hypothetical protein AC578_3015 [Mycosphaerella eumusae] 113 1e-26 KNG44258.1 opsin-like protein [Stemphylium lycopersici] 111 5e-26 OAL05731.1 family A G protein-coupled receptor-like protein [Sta... 111 6e-26 XP_001791031.1 hypothetical protein SNOG_00341 [Parastagonospora... 111 6e-26 XP_018391147.1 putative opsin-like protein [Alternaria alternata... 110 1e-25 >XP_018040624.1 family A G protein-coupled receptor-like protein [Paraphaeosphaeria sporulosa] OAG10259.1 family A G protein-coupled receptor-like protein [Paraphaeosphaeria sporulosa] Length = 337 Score = 124 bits (310), Expect = 2e-30 Identities = 57/78 (73%), Positives = 66/78 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LTS LWLLYPIAWG+ EGGNVI +SEA FYGILD+LAKPVFGALLI GH+NIEPSRLG+ Sbjct: 213 LTSLLWLLYPIAWGVCEGGNVIAPDSEAIFYGILDLLAKPVFGALLIWGHRNIEPSRLGL 272 Query: 183 NIVDYGSEDTIHEKKHLN 236 NI DY ++ +HEK+ N Sbjct: 273 NITDYDNDVAVHEKRATN 290 >GAM85256.1 hypothetical protein ANO11243_032600 [fungal sp. No.11243] Length = 313 Score = 120 bits (301), Expect = 2e-29 Identities = 55/82 (67%), Positives = 68/82 (82%), Gaps = 2/82 (2%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LTSFLW LYPIAWG+SEGGNVI N EA+FYG+LDVLAKPVFGALLI GH+NI+P+RLG+ Sbjct: 205 LTSFLWFLYPIAWGISEGGNVISPNGEAFFYGVLDVLAKPVFGALLIFGHRNIDPARLGL 264 Query: 183 NIVDYGSEDTI--HEKKHLNGS 242 +I DY +D + + K H +G+ Sbjct: 265 DIQDYSEKDAMVSNSKHHHHGT 286 >EME38958.1 hypothetical protein DOTSEDRAFT_75607 [Dothistroma septosporum NZE10] Length = 315 Score = 119 bits (299), Expect = 5e-29 Identities = 55/81 (67%), Positives = 68/81 (83%), Gaps = 1/81 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+F+W LYPIAWGLSEGGNVI S+ EA FYG+LD++AKPVFGALLI GH+NI P+ LG+ Sbjct: 209 LTAFMWTLYPIAWGLSEGGNVISSDGEAAFYGVLDLIAKPVFGALLIWGHRNISPADLGL 268 Query: 183 NIVDYGSEDTI-HEKKHLNGS 242 I DYG+++ I HEK H NG+ Sbjct: 269 AIHDYGADEPIFHEKNHRNGN 289 >XP_008030750.1 hypothetical protein SETTUDRAFT_165763 [Setosphaeria turcica Et28A] EOA81231.1 hypothetical protein SETTUDRAFT_165763 [Setosphaeria turcica Et28A] Length = 310 Score = 117 bits (294), Expect = 2e-28 Identities = 52/74 (70%), Positives = 63/74 (85%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYPIAWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+P+RLG+ Sbjct: 207 LTAFLWILYPIAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPARLGL 266 Query: 183 NIVDYGSEDTIHEK 224 I DY + +HEK Sbjct: 267 QIRDYNDDTMLHEK 280 >XP_016756173.1 family A G protein-coupled receptor-like protein [Sphaerulina musiva SO2202] EMF08052.1 family A G protein-coupled receptor-like protein [Sphaerulina musiva SO2202] Length = 317 Score = 117 bits (292), Expect = 6e-28 Identities = 53/75 (70%), Positives = 65/75 (86%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYP+AWG+SEGGN+I +SEA FYGILD+LAKP+FGALLI GH+NI P++LG+ Sbjct: 201 LTAFLWILYPVAWGVSEGGNIIAPDSEAVFYGILDLLAKPLFGALLIWGHRNISPAQLGL 260 Query: 183 NIVDYGSED-TIHEK 224 I DYG ED IHEK Sbjct: 261 TIHDYGGEDPVIHEK 275 >XP_003838475.1 hypothetical protein LEMA_P114110.1 [Leptosphaeria maculans JN3] CBX94996.1 hypothetical protein LEMA_P114110.1 [Leptosphaeria maculans JN3] Length = 303 Score = 116 bits (291), Expect = 6e-28 Identities = 52/76 (68%), Positives = 64/76 (84%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LTSFLW+LYP+AWGL EGGNVI +SEA FYG+LD LAKP+FGALLI GH+N++P+RLG+ Sbjct: 201 LTSFLWILYPVAWGLCEGGNVISPDSEAVFYGVLDFLAKPIFGALLIWGHRNVDPARLGL 260 Query: 183 NIVDYGSED-TIHEKK 227 I DYG D +HEK+ Sbjct: 261 AIRDYGDADAVVHEKR 276 >XP_014561228.1 hypothetical protein COCVIDRAFT_87288 [Bipolaris victoriae FI3] EUN31652.1 hypothetical protein COCVIDRAFT_87288 [Bipolaris victoriae FI3] Length = 306 Score = 116 bits (291), Expect = 6e-28 Identities = 52/75 (69%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYPIAWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+PSRLG+ Sbjct: 205 LTAFLWILYPIAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPSRLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 QIRDYNDDTMLQEKR 279 >XP_007712526.1 hypothetical protein COCCADRAFT_26476 [Bipolaris zeicola 26-R-13] EUC33157.1 hypothetical protein COCCADRAFT_26476 [Bipolaris zeicola 26-R-13] Length = 306 Score = 116 bits (291), Expect = 6e-28 Identities = 52/75 (69%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYPIAWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+PSRLG+ Sbjct: 205 LTAFLWILYPIAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPSRLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 QIRDYNDDTMLQEKR 279 >XP_007685632.1 hypothetical protein COCMIDRAFT_88800 [Bipolaris oryzae ATCC 44560] BAH28808.1 putative opsin-like protein [Bipolaris oryzae] EUC47913.1 hypothetical protein COCMIDRAFT_88800 [Bipolaris oryzae ATCC 44560] Length = 306 Score = 115 bits (288), Expect = 2e-27 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYPIAWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+P+RLG+ Sbjct: 205 LTAFLWILYPIAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 QIRDYNDDTMLQEKR 279 >XP_007698250.1 hypothetical protein COCSADRAFT_25007 [Bipolaris sorokiniana ND90Pr] EMD65353.1 hypothetical protein COCSADRAFT_25007 [Bipolaris sorokiniana ND90Pr] Length = 306 Score = 115 bits (288), Expect = 2e-27 Identities = 51/75 (68%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYPIAWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+P+RLG+ Sbjct: 205 LTAFLWILYPIAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 QIRDYNDDTMLQEKR 279 >XP_014083612.1 hypothetical protein COCC4DRAFT_184935 [Bipolaris maydis ATCC 48331] EMD90083.1 hypothetical protein COCHEDRAFT_1139038 [Bipolaris maydis C5] ENI09703.1 hypothetical protein COCC4DRAFT_184935 [Bipolaris maydis ATCC 48331] Length = 306 Score = 115 bits (287), Expect = 2e-27 Identities = 50/75 (66%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYP+AWGLSEGGNVI +SEA FYG+LD LAKPVFGALL+ GH+NI+P+RLG+ Sbjct: 205 LTAFLWILYPVAWGLSEGGNVIAPDSEAVFYGVLDFLAKPVFGALLLWGHRNIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 QIRDYNDDTMLQEKR 279 >XP_007922601.1 hypothetical protein MYCFIDRAFT_56178 [Pseudocercospora fijiensis CIRAD86] EME86979.1 hypothetical protein MYCFIDRAFT_56178 [Pseudocercospora fijiensis CIRAD86] Length = 301 Score = 114 bits (285), Expect = 4e-27 Identities = 53/79 (67%), Positives = 66/79 (83%), Gaps = 1/79 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+ LW LYPIAWG+SEGGNVI +SEA FYGILD+LAKP FGALL+ GH+NI P++LG+ Sbjct: 201 LTALLWTLYPIAWGVSEGGNVIAPDSEAVFYGILDILAKPGFGALLLWGHRNISPAQLGL 260 Query: 183 NIVDY-GSEDTIHEKKHLN 236 +I DY G++ IHEK+H N Sbjct: 261 SIRDYDGTDPVIHEKRHGN 279 >XP_003847675.1 hypothetical protein MYCGRDRAFT_106573 [Zymoseptoria tritici IPO323] EGP82651.1 hypothetical protein MYCGRDRAFT_106573 [Zymoseptoria tritici IPO323] Length = 304 Score = 114 bits (285), Expect = 5e-27 Identities = 53/76 (69%), Positives = 65/76 (85%), Gaps = 1/76 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW LYPIAWG++EGGN+I +SEA FYGILDVLAKPVFGALLI GH+NI P++LG+ Sbjct: 204 LTAFLWTLYPIAWGVAEGGNIIAPDSEAVFYGILDVLAKPVFGALLIWGHRNISPAQLGL 263 Query: 183 NIVDY-GSEDTIHEKK 227 I DY G++ IHEK+ Sbjct: 264 TIRDYNGTDAVIHEKR 279 >KJY02165.1 family A G protein-coupled receptor-like protein [Zymoseptoria brevis] Length = 304 Score = 114 bits (284), Expect = 6e-27 Identities = 53/75 (70%), Positives = 64/75 (85%), Gaps = 1/75 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW LYPIAWG++EGGN+I +SEA FYGILDVLAKPVFGALLI GH+NI P++LG+ Sbjct: 204 LTAFLWTLYPIAWGVAEGGNIIAPDSEAVFYGILDVLAKPVFGALLIWGHRNISPAQLGL 263 Query: 183 NIVDY-GSEDTIHEK 224 I DY G++ IHEK Sbjct: 264 TIRDYNGTDPVIHEK 278 >KXT13595.1 hypothetical protein AC579_8497 [Pseudocercospora musae] Length = 309 Score = 113 bits (282), Expect = 1e-26 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 1/79 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW LYPIAWG+SEGGNVI +SEA FYGILD+LAKP FGALL+ GH+NI P++LG+ Sbjct: 201 LTAFLWTLYPIAWGVSEGGNVIPPDSEAIFYGILDILAKPGFGALLMWGHRNISPAQLGL 260 Query: 183 NIVDY-GSEDTIHEKKHLN 236 I DY G++ IHEK H N Sbjct: 261 AIRDYDGTDPVIHEKHHGN 279 >KXS96415.1 hypothetical protein AC578_3015 [Mycosphaerella eumusae] Length = 309 Score = 113 bits (282), Expect = 1e-26 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 1/79 (1%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW LYPIAWG+SEGGNVI +SEA FYGILD+LAKP FGALL+ GH+NI P++LG+ Sbjct: 201 LTAFLWTLYPIAWGVSEGGNVIPPDSEAIFYGILDILAKPGFGALLMWGHRNISPAQLGL 260 Query: 183 NIVDY-GSEDTIHEKKHLN 236 I DY G++ IHEK H N Sbjct: 261 AIRDYDGTDPVIHEKHHGN 279 >KNG44258.1 opsin-like protein [Stemphylium lycopersici] Length = 302 Score = 111 bits (278), Expect = 5e-26 Identities = 47/75 (62%), Positives = 62/75 (82%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYP+AWGL+EGGN+I +SEA FYG+LD LAKP FGALL+ GH+NI+P+RLG+ Sbjct: 205 LTAFLWILYPVAWGLAEGGNIIAPDSEAVFYGVLDFLAKPCFGALLLWGHRNIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 I DY + + EK+ Sbjct: 265 AIKDYDGDQLVQEKR 279 >OAL05731.1 family A G protein-coupled receptor-like protein [Stagonospora sp. SRC1lsM3a] Length = 300 Score = 111 bits (277), Expect = 6e-26 Identities = 49/80 (61%), Positives = 64/80 (80%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+ LW+LYPIAWG+ EGGN+I +SEA FYG+LD AKPVFGALLI GHK+I+P+RLG+ Sbjct: 205 LTTVLWILYPIAWGVCEGGNLISPDSEAVFYGVLDFFAKPVFGALLIWGHKDIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKKHLNGS 242 I DY + +HEK+ +G+ Sbjct: 265 AIKDYEGDAAVHEKRRPDGA 284 >XP_001791031.1 hypothetical protein SNOG_00341 [Parastagonospora nodorum SN15] EAT91836.1 hypothetical protein SNOG_00341 [Parastagonospora nodorum SN15] Length = 302 Score = 111 bits (277), Expect = 6e-26 Identities = 49/75 (65%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 LT+FLW+LYP+AWG++EGGNVI +SEA FY ILD LAKPVFGALLI GH+NI+P+RLG+ Sbjct: 206 LTAFLWILYPVAWGVAEGGNVISPDSEAIFYSILDFLAKPVFGALLIWGHRNIDPARLGL 265 Query: 183 NIVDYGSEDTIHEKK 227 I DY + ++ EK+ Sbjct: 266 AIKDYDHDTSVSEKR 280 >XP_018391147.1 putative opsin-like protein [Alternaria alternata] OAG25726.1 putative opsin-like protein [Alternaria alternata] Length = 307 Score = 110 bits (276), Expect = 1e-25 Identities = 47/75 (62%), Positives = 63/75 (84%) Frame = +3 Query: 3 LTSFLWLLYPIAWGLSEGGNVIGSNSEAYFYGILDVLAKPVFGALLIMGHKNIEPSRLGI 182 +T+ LW+LYPIAWG++EGGNVI +SEA FYG+LD LAKP FGALL+ GHK+I+P+RLG+ Sbjct: 205 MTALLWILYPIAWGVAEGGNVIAPDSEAVFYGVLDFLAKPCFGALLLWGHKDIDPARLGL 264 Query: 183 NIVDYGSEDTIHEKK 227 +I DY + +HEK+ Sbjct: 265 SIKDYDGDAMVHEKR 279