BLASTX nr result
ID: Magnolia22_contig00037511
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00037511 (707 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY66970.1 UPF0481 protein [Ananas comosus] 58 4e-06 >OAY66970.1 UPF0481 protein [Ananas comosus] Length = 538 Score = 57.8 bits (138), Expect = 4e-06 Identities = 34/82 (41%), Positives = 43/82 (52%), Gaps = 2/82 (2%) Frame = +3 Query: 468 LPTIHKVPQRIRQANKDVYEPYEPQIVSIGPYXXXXXXXXXXXXXXYQ--QSILFRNPKH 641 L TI+KVPQ IR+ + YEP ++SIGPY + IL NPK Sbjct: 5 LCTIYKVPQHIREVERHAYEPI---VLSIGPYHYGTPPLQAMEKEKWNCLDYILKLNPKR 61 Query: 642 VLEDYHTAIAKLENEARSCYSE 707 L DY IA+LEN R+CY+E Sbjct: 62 DLHDYLRVIARLENHVRNCYTE 83