BLASTX nr result
ID: Magnolia22_contig00035815
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035815 (454 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010274547.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 6e-08 >XP_010274547.1 PREDICTED: pentatricopeptide repeat-containing protein At1g09900-like [Nelumbo nucifera] Length = 894 Score = 60.8 bits (146), Expect = 6e-08 Identities = 40/95 (42%), Positives = 53/95 (55%), Gaps = 1/95 (1%) Frame = +2 Query: 149 LSPKVRYAPLLLFFPKSSNFQTLDSQTRPHSSSSSATEFDVLDQFLPSIDHR-PSPINPI 325 +SP PL F + + SQTR S SS++T FD LDQF P D P+ +N Sbjct: 17 VSPNFSKTPLFRFGGPPTTL--VSSQTRNFSFSSTSTSFDFLDQFSPFRDSSSPNVVNSN 74 Query: 326 ERRGIVLGLSKIIKRGQCVALKSFLLEPSPSFLAR 430 ERR I++GLSK+IK G+ L+ F L SFL + Sbjct: 75 ERRQIIVGLSKMIKHGEGFYLQGFSLVFCASFLVK 109