BLASTX nr result
ID: Magnolia22_contig00035786
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035786 (331 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010268254.1 PREDICTED: pentatricopeptide repeat-containing pr... 99 9e-22 EOY30687.1 Tetratricopeptide repeat-like superfamily protein [Th... 97 2e-21 XP_017982165.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 8e-21 XP_011048336.1 PREDICTED: putative pentatricopeptide repeat-cont... 95 2e-20 XP_011048335.1 PREDICTED: putative pentatricopeptide repeat-cont... 95 2e-20 KJB64999.1 hypothetical protein B456_010G075400 [Gossypium raimo... 95 2e-20 XP_017644984.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-20 XP_016754718.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-20 XP_012452684.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-20 XP_011048334.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 2e-20 XP_015579068.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 3e-20 OAY60598.1 hypothetical protein MANES_01G124700 [Manihot esculenta] 94 5e-20 GAV87549.1 PPR domain-containing protein/PPR_2 domain-containing... 94 5e-20 XP_017255566.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 7e-20 XP_002325018.2 hypothetical protein POPTR_0018s09280g [Populus t... 93 7e-20 XP_012074695.1 PREDICTED: pentatricopeptide repeat-containing pr... 93 7e-20 XP_018859134.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 2e-19 XP_015898423.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 4e-19 XP_010047699.1 PREDICTED: pentatricopeptide repeat-containing pr... 90 8e-19 KDO66510.1 hypothetical protein CISIN_1g005454mg [Citrus sinensis] 90 8e-19 >XP_010268254.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Nelumbo nucifera] XP_010268255.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Nelumbo nucifera] Length = 692 Score = 98.6 bits (244), Expect = 9e-22 Identities = 41/49 (83%), Positives = 45/49 (91%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RIVKNIRVC DCH+FMKFV K+T R I+LRDSNRFHHFVGG+CSCKDYW Sbjct: 644 RIVKNIRVCGDCHVFMKFVCKITKRPIILRDSNRFHHFVGGECSCKDYW 692 >EOY30687.1 Tetratricopeptide repeat-like superfamily protein [Theobroma cacao] Length = 697 Score = 97.4 bits (241), Expect = 2e-21 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCHLFMKFVSK+ R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 649 RIMKNIRVCGDCHLFMKFVSKIIGRPIILRDSNRFHHFVGGSCSCKDYW 697 >XP_017982165.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070 [Theobroma cacao] Length = 697 Score = 95.9 bits (237), Expect = 8e-21 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCHLFMKF SK+ R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 649 RIMKNIRVCGDCHLFMKFASKIIGRPIILRDSNRFHHFVGGSCSCKDYW 697 >XP_011048336.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 isoform X3 [Populus euphratica] Length = 574 Score = 94.7 bits (234), Expect = 2e-20 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIR C+DCH+FMKFVS +T R ++LRDSNRFHHFV GQCSCKDYW Sbjct: 526 RIIKNIRTCADCHIFMKFVSNITRRPVILRDSNRFHHFVQGQCSCKDYW 574 >XP_011048335.1 PREDICTED: putative pentatricopeptide repeat-containing protein At5g09950 isoform X2 [Populus euphratica] Length = 577 Score = 94.7 bits (234), Expect = 2e-20 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIR C+DCH+FMKFVS +T R ++LRDSNRFHHFV GQCSCKDYW Sbjct: 529 RIIKNIRTCADCHIFMKFVSNITRRPVILRDSNRFHHFVQGQCSCKDYW 577 >KJB64999.1 hypothetical protein B456_010G075400 [Gossypium raimondii] Length = 608 Score = 94.7 bits (234), Expect = 2e-20 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMK VSKV R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 560 RIMKNIRVCGDCHMFMKLVSKVIGRPIILRDSNRFHHFVGGSCSCKDYW 608 >XP_017644984.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Gossypium arboreum] Length = 695 Score = 94.7 bits (234), Expect = 2e-20 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMK VSKV R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 647 RIMKNIRVCGDCHMFMKLVSKVIGRPIILRDSNRFHHFVGGSCSCKDYW 695 >XP_016754718.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Gossypium hirsutum] Length = 695 Score = 94.7 bits (234), Expect = 2e-20 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMK VSKV R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 647 RIMKNIRVCGDCHMFMKLVSKVIGRPIILRDSNRFHHFVGGSCSCKDYW 695 >XP_012452684.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Gossypium raimondii] XP_012452685.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Gossypium raimondii] KJB65000.1 hypothetical protein B456_010G075400 [Gossypium raimondii] Length = 695 Score = 94.7 bits (234), Expect = 2e-20 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMK VSKV R I+LRDSNRFHHFVGG CSCKDYW Sbjct: 647 RIMKNIRVCGDCHMFMKLVSKVIGRPIILRDSNRFHHFVGGSCSCKDYW 695 >XP_011048334.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like isoform X1 [Populus euphratica] Length = 695 Score = 94.7 bits (234), Expect = 2e-20 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIR C+DCH+FMKFVS +T R ++LRDSNRFHHFV GQCSCKDYW Sbjct: 647 RIIKNIRTCADCHIFMKFVSNITRRPVILRDSNRFHHFVQGQCSCKDYW 695 >XP_015579068.1 PREDICTED: pentatricopeptide repeat-containing protein At4g02750 [Ricinus communis] Length = 694 Score = 94.4 bits (233), Expect = 3e-20 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMKFVS++T R ++LRDSNRFHHFV G+CSC DYW Sbjct: 646 RIIKNIRVCGDCHVFMKFVSEITGRQVILRDSNRFHHFVAGKCSCNDYW 694 >OAY60598.1 hypothetical protein MANES_01G124700 [Manihot esculenta] Length = 694 Score = 93.6 bits (231), Expect = 5e-20 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMKFVSK+T R I+LRDSNRFHHF G+CSC DYW Sbjct: 646 RIIKNIRVCGDCHVFMKFVSKITGRQIILRDSNRFHHFGAGKCSCNDYW 694 >GAV87549.1 PPR domain-containing protein/PPR_2 domain-containing protein/DYW_deaminase domain-containing protein [Cephalotus follicularis] Length = 695 Score = 93.6 bits (231), Expect = 5e-20 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMKF+SK T RHI+LRDS FHHFV G+CSCKDYW Sbjct: 647 RILKNIRVCGDCHVFMKFISKTTGRHIILRDSTIFHHFVAGKCSCKDYW 695 >XP_017255566.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Daucus carota subsp. sativus] Length = 695 Score = 93.2 bits (230), Expect = 7e-20 Identities = 39/49 (79%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVCSDCH FMKFVS + +R I+LRDSNRFHHFVGG CSCKD W Sbjct: 647 RILKNIRVCSDCHAFMKFVSNIIERPIILRDSNRFHHFVGGHCSCKDLW 695 >XP_002325018.2 hypothetical protein POPTR_0018s09280g [Populus trichocarpa] EEF03583.2 hypothetical protein POPTR_0018s09280g [Populus trichocarpa] Length = 695 Score = 93.2 bits (230), Expect = 7e-20 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIR C+DCH+FMKFVS +T R ++LRDSNRFHHFV G+CSCKDYW Sbjct: 647 RIIKNIRTCADCHIFMKFVSNITRRPVILRDSNRFHHFVEGKCSCKDYW 695 >XP_012074695.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Jatropha curcas] XP_012074696.1 PREDICTED: pentatricopeptide repeat-containing protein At2g22070-like [Jatropha curcas] KDP35701.1 hypothetical protein JCGZ_10473 [Jatropha curcas] Length = 696 Score = 93.2 bits (230), Expect = 7e-20 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH+FMKFVSK+ +R I+LRDSNRFHHF+ G+CSC DYW Sbjct: 648 RIIKNIRVCGDCHVFMKFVSKLIERPIILRDSNRFHHFIAGKCSCNDYW 696 >XP_018859134.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Juglans regia] Length = 695 Score = 92.0 bits (227), Expect = 2e-19 Identities = 38/49 (77%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH FMKFVSK+ R I+LRDSNRFHHF+GG+CSCKD W Sbjct: 647 RIIKNIRVCGDCHEFMKFVSKIIGRPIILRDSNRFHHFIGGKCSCKDNW 695 >XP_015898423.1 PREDICTED: pentatricopeptide repeat-containing protein At3g62890-like [Ziziphus jujuba] Length = 695 Score = 90.9 bits (224), Expect = 4e-19 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCH FMKFVSK+ R I+LRDSNRFHHF GG CSCKD W Sbjct: 647 RIIKNIRVCGDCHEFMKFVSKIVKRTIILRDSNRFHHFTGGMCSCKDNW 695 >XP_010047699.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Eucalyptus grandis] XP_010047700.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Eucalyptus grandis] XP_010047701.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Eucalyptus grandis] XP_010047702.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Eucalyptus grandis] Length = 696 Score = 90.1 bits (222), Expect = 8e-19 Identities = 34/49 (69%), Positives = 43/49 (87%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC+DCH FMK+ S++ RHI+LRD NR+HHF+GG+CSC DYW Sbjct: 648 RIIKNIRVCTDCHAFMKYASELIGRHIILRDYNRYHHFIGGKCSCNDYW 696 >KDO66510.1 hypothetical protein CISIN_1g005454mg [Citrus sinensis] Length = 696 Score = 90.1 bits (222), Expect = 8e-19 Identities = 38/49 (77%), Positives = 41/49 (83%) Frame = +3 Query: 3 RIVKNIRVCSDCHLFMKFVSKVTDRHIVLRDSNRFHHFVGGQCSCKDYW 149 RI+KNIRVC DCHLFMKF S + R I+LRDSNRFHHFVGG CSCKD W Sbjct: 648 RIMKNIRVCGDCHLFMKFASDIIGRTIILRDSNRFHHFVGGNCSCKDNW 696